Sequence of DPV Mint virus 1

Mint virus 1 isolate Redefined Murray heat shock protein 70-like gene, complete cds.

ACC No: AY902479

Dated: 2005-08-19 | Length: 1815 | CRC: -1565899397

                !!NA_SEQUENCE 1.0
ID   AY902479   standard; genomic RNA; VRL; 1815 BP.
XX
AC   AY902479;
XX
SV   AY902479.1
XX
DT   25-APR-2005 (Rel. 83, Created)
DT   19-AUG-2005 (Rel. 84, Last updated, Version 2)
XX
DE   Mint virus 1 isolate Redefined Murray heat shock protein 70-like gene,
DE   complete cds.
XX
KW   .
XX
OS   Mint virus 1
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-1815
RA   Tzanetakis I.E., Postman J.D., Martin R.R.;
RT   "Characterization of a novel member of the Closteroviridae from Mentha";
RL   Phytopathology 95:1043-1048(2005).
XX
RN   [2]
RP   1-1815
RA   Tzanetakis I.E.;
RT   ;
RL   Submitted (21-JAN-2005) to the EMBL/GenBank/DDBJ databases.
RL   Botany and Plant Pathology, Oregon State University and USDA-ARS, 3420
RL   Orchard Ave, Corvallis, OR 97330, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1815
FT                   /country="USA:Albany, Oregon"
FT                   /db_xref="taxon:300740"
FT                   /mol_type="genomic RNA"
FT                   /organism="Mint virus 1"
FT                   /isolate="Redefined Murray"
FT   CDS             1. .1815
FT                   /codon_start=1
FT                   /db_xref="GOA:Q52V38"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="UniProt/TrEMBL:Q52V38"
FT                   /note="HSP70h; p66"
FT                   /product="heat shock protein 70-like"
FT                   /protein_id="AAX98725.1"
FT                   /translation="MVVFGLDFGTTFSTLSVLKANEVFVLKQNDSPYIPTYLFFYKNSR
FT                   EVAYGYDAERLLHSKGSEGGFFRDLKRWIGCTERNYASYLEKLAPSYTTSIDSSIDNCD
FT                   FRIPMLNCFNSSCDMKLSLPDLVASFVRCIVTDGENSFSVKCSGVVCSVPAAFTSTQRN
FT                   FIMECVSLSGFHCSHIINEPSAAAFSAFRKLSPSERFVMVYDFGGGTFDVSAVSVRNST
FT                   FVVKASGGDMNLGGRDVDRALLESIHEKAGVKHVDYTVDISSIKEKVSQALSSFVYDLP
FT                   VGKEFVSVLVTVEDVSKVVVPFIERTVKIMHSVYKSFIESSLDVSTMNHDRKCSVVTVG
FT                   GSSYLPGLKNVIEAIPFVDRVVEVPDARSAVSAGCALYSLCLSSNSSMLLVDCATNTLT
FT                   TPSYTCETIVVVPKGAPIPFSGKRKIFLSKATRSKKFYAALFEGEYQKCALNELVYSHN
FT                   VPLSDLGVTSDIPRSLPMTLEVQISSVGTVKFDIVTDGGGRYTVGKDRPYDFSSRSAPS
FT                   RNVVRMSDSLQRRTSSILYSSRSERVRSSIREDVRLKLYSPESELAPNDVVVQCGLNDE
FT                   EKSDCAKYLDSSVGKIVRGASILKLDLD"
XX
SQ   Sequence 1815 BP; 433 A; 398 C; 456 G; 528 T; 0 other;

AY902479  Length: 1815  August 30, 2005 08:42  Type: N  Check: 7939  ..

       1  atggtcgttt tcggtctcga ctttggaact actttttcaa cactctcagt
      51  ccttaaggcg aatgaggtgt tcgttcttaa gcagaatgac tctccgtata
     101  tacccactta tcttttcttt tataagaatt ctcgcgaagt ggcatacgga
     151  tacgacgcgg aacgtcttct tcactcaaag ggatcagaag ggggtttctt
     201  tcgcgatctc aaacgctgga tcggttgcac ggaacgcaat tacgcgtcct
     251  accttgagaa gctggctccc tcgtacacca cgtcgatcga ctcttcaata
     301  gataattgtg atttcagaat tccaatgttg aattgtttta actcgtcttg
     351  cgacatgaag ctgtcgctac ccgatttggt ggcaagcttc gtacggtgca
     401  tcgtgacgga tggagagaat tctttcagcg ttaagtgcag cggggttgtg
     451  tgttcagtgc ccgctgcttt cacctcgact cagaggaatt tcattatgga
     501  atgcgtttca ctgagtggtt ttcactgttc gcacatcatc aatgaacctt
     551  cggctgctgc tttttccgct tttcggaaat tgtcacccag cgagaggttc
     601  gttatggttt acgatttcgg tgggggtaca tttgatgtct cggccgtctc
     651  tgttagaaac agcactttcg tagttaaagc gtcagggggt gacatgaacc
     701  tcggcggtcg cgacgtagat agggcgttac tcgagtcgat acacgagaaa
     751  gcgggtgtta agcacgtaga ctacaccgtt gatatctcgt ctatcaagga
     801  gaaggtctct caggctctta gctcattcgt gtatgatcta ccggttggga
     851  aagagttcgt gagtgtccta gtcactgttg aggatgtgtc gaaagtcgtg
     901  gtacctttta ttgaacgcac tgtaaagatc atgcatagtg tttacaaaag
     951  tttcattgaa tcttcactcg atgtgtctac tatgaatcac gatcgcaaat
    1001  gcagcgttgt cacagttggg ggttcctcgt atttgcccgg tctcaagaac
    1051  gttattgaag caataccgtt cgtggacaga gttgttgagg ttccagacgc
    1101  tcgttcagcc gtttcagctg ggtgtgcgct atactctctt tgcctcagta
    1151  gcaactcatc gatgcttctc gttgattgtg ctaccaacac tttgactaca
    1201  ccctcttaca cttgcgaaac gatagtcgtg gtgcctaaag gtgccccgat
    1251  tcctttctcg gggaagagaa aaatttttct ctctaaggca acacgcagta
    1301  agaagttcta cgccgcctta ttcgaagggg aataccaaaa gtgtgcatta
    1351  aatgaactcg tttactcgca caacgtaccg ttgagtgatt tgggtgtgac
    1401  ctctgatata ccgaggagtc taccaatgac tctcgaggta caaataagca
    1451  gtgtggggac tgtaaagttc gatatcgtca ccgatggtgg tgggcgttac
    1501  actgtgggta aagatcgacc ttatgatttc tccagtagaa gtgctccttc
    1551  aagaaacgtc gtgcgaatgt ctgattcgtt acagcggagg acgtcgtcca
    1601  tcctatactc gtcacgcagt gaaagagtac gttctagtat ccgagaagac
    1651  gttcgtctaa aattatattc tcccgagtcc gaattagcgc cgaacgacgt
    1701  tgtggttcag tgcggtttaa acgacgagga aaagagtgac tgtgcgaaat
    1751  atttggatag ttcggttgga aaaattgtgc gaggcgccag cattctgaaa
    1801  ctcgacctag attga