Sequence of DPV Mint virus 1

Mint virus 1 isolate Redefined Murray major coat protein gene, complete cds.

ACC No: AY902482

Dated: 2005-08-19 | Length: 606 | CRC: 115140112

                !!NA_SEQUENCE 1.0
ID   AY902482   standard; genomic RNA; VRL; 606 BP.
XX
AC   AY902482;
XX
SV   AY902482.1
XX
DT   25-APR-2005 (Rel. 83, Created)
DT   19-AUG-2005 (Rel. 84, Last updated, Version 2)
XX
DE   Mint virus 1 isolate Redefined Murray major coat protein gene, complete
DE   cds.
XX
KW   .
XX
OS   Mint virus 1
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-606
RA   Tzanetakis I.E., Postman J.D., Martin R.R.;
RT   "Characterization of a novel member of the Closteroviridae from Mentha";
RL   Phytopathology 95:1043-1048(2005).
XX
RN   [2]
RP   1-606
RA   Tzanetakis I.E.;
RT   ;
RL   Submitted (21-JAN-2005) to the EMBL/GenBank/DDBJ databases.
RL   Botany and Plant Pathology, Oregon State University and USDA-ARS, 3420
RL   Orchard Ave, Corvallis, OR 97330, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .606
FT                   /country="USA:Albany, Oregon"
FT                   /db_xref="taxon:300740"
FT                   /mol_type="genomic RNA"
FT                   /organism="Mint virus 1"
FT                   /isolate="Redefined Murray"
FT   CDS             1. .606
FT                   /codon_start=1
FT                   /db_xref="GOA:Q52V35"
FT                   /db_xref="UniProt/TrEMBL:Q52V35"
FT                   /note="CP; p22"
FT                   /product="major coat protein"
FT                   /protein_id="AAX98728.1"
FT                   /translation="MVDTAGKLAVIDAFNVEDERIVSSVSDLAEIRQKFEKFVTDKLQG
FT                   DLKDLDLHLGLILVAFAIKTTSRQAVKGDAEFVNYTLSGHVSTATEKDITEFLNSLPQL
FT                   KDRKNKARVFCRSFAKEYIKICRSHANSLPKQTRAIKLGIPDRYHYLQADFVTDCSELT
FT                   DEEQAVLLHGRNHAVAPINSATTPIVTNLYELGGGKRN"
XX
SQ   Sequence 606 BP; 181 A; 143 C; 139 G; 143 T; 0 other;

 AY902482  Length: 606  August 30, 2005 08:42  Type: N  Check: 5583  ..

       1  atggttgaca cggccgggaa actcgccgtc attgacgcct tcaacgttga
      51  ggacgaaagg attgtctcat ctgtctcaga cttggctgaa atcaggcaaa
     101  aatttgaaaa atttgtgact gacaaacttc agggagatct caaggatctc
     151  gacttacact tgggtctcat actagtcgca tttgcgatca aaactacctc
     201  aaggcaggcc gtaaaaggcg acgctgaatt tgttaattac actctttcgg
     251  gtcacgtttc gacagcaact gagaaagata taaccgaatt cctcaattcc
     301  ctccctcaat tgaaagatag gaagaataag gctagagtgt tttgccgtag
     351  ctttgcgaag gaatacataa aaatttgcag atcccacgct aattctctcc
     401  cgaagcaaac gcgagcgatt aaactgggga tacctgacag gtaccactat
     451  ttgcaagcag atttcgttac agattgctcc gaactaaccg acgaggaaca
     501  agccgtgtta ctgcacggga ggaaccacgc ggtggcacct attaacagtg
     551  ctactacgcc tattgtcacc aacctgtacg agctcggagg tggaaaacgc
     601  aactga