Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone JX-2-17 coat protein gene, complete cds.

ACC No: AY953981

Dated: 2008-08-24 | Length: 672 | CRC: -1855014593

                
ID   AY953981; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   AY953981;
XX
DT   28-MAR-2006 (Rel. 87, Created)
DT   24-AUG-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Citrus tristeza virus clone JX-2-17 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18626763.
RA   Jiang B., Hong N., Wang G.P., Hu J., Zhang J.K., Wang C.X., Liu Y.,
RA   Fan X.D.;
RT   "Characterization of Citrus tristeza virus strains from southern China
RT   based on analysis of restriction patterns and sequences of their coat
RT   protein genes";
RL   Virus Genes 37(2):185-192(2008).
XX
RN   [2]
RP   1-672
RA   Zhang J., Hong N., Wang G.;
RT   ;
RL   Submitted (05-MAR-2005) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Huazhong Agricultural University, No.1
RL   Shizishan, Wuhan, Hubei 430062, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /clone="JX-2-17"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q9DTF8"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DTF8"
FT                   /protein_id="AAX55222.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 127 C; 176 G; 178 T; 0 other;

ay953981 Length: 672  24-AUG-2008  Type: N  Check: 2257  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcgg cggagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtacgtca gttaggtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcaccta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcac tgcaaagtga cgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaggtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga