Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone HN-K coat protein gene, complete cds.

ACC No: AY953982

Dated: 2008-08-24 | Length: 672 | CRC: 1682488215

                
ID   AY953982; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   AY953982;
XX
DT   28-MAR-2006 (Rel. 87, Created)
DT   24-AUG-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Citrus tristeza virus clone HN-K coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18626763.
RA   Jiang B., Hong N., Wang G.P., Hu J., Zhang J.K., Wang C.X., Liu Y.,
RA   Fan X.D.;
RT   "Characterization of Citrus tristeza virus strains from southern China
RT   based on analysis of restriction patterns and sequences of their coat
RT   protein genes";
RL   Virus Genes 37(2):185-192(2008).
XX
RN   [2]
RP   1-672
RA   Zhang J., Hong N., Wang G.;
RT   ;
RL   Submitted (05-MAR-2005) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Huazhong Agricultural University, No.1
RL   Shizishan, Wuhan, Hubei 430062, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /clone="HN-K"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q1XAM7"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q1XAM7"
FT                   /protein_id="AAX55223.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKEKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCGQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 190 A; 121 C; 177 G; 184 T; 0 other;

ay953982 Length: 672  24-AUG-2008  Type: N  Check: 4705  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacaat gttgttgcag cggagtcttc tttcggttct gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ccgctttgaa cagagatttg tttcttactt tgaaagagaa
     201  gtatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgatgacact
     301  acgggtataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt aggactaacg atgcccttta tttagccttt
     451  tgtggacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc ggatttcttg accggagctg
     551  gcttgactga tttagagtgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga