Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate C315-14 clone C9 p20 gene, complete cds.

ACC No: AY962327

Dated: 2006-03-31 | Length: 557 | CRC: 38089470

                
ID   AY962327   standard; genomic RNA; VRL; 557 BP.
XX
AC   AY962327;
XX
SV   AY962327.1
XX
DT   31-MAR-2006 (Rel. 87, Created)
DT   31-MAR-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate C315-14 clone C9 p20 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-557
RA   Iglesias N.G., Marengo J.M., Riquelme K.L., Costa N.B., Plata M.I.,
RA   Semorile L.C.;
RT   "Characterization of the population structure in a grapefruit isolate of
RT   Citrus tristeza virus (CTV) selected for pre-immunization assays in
RT   Argentina";
RL   Unpublished.
XX
RN   [2]
RP   1-557
RA   Iglesias N.G., Marengo J.M., Riquelme K.L., Costa N.B., Plata M.I.,
RA   Semorile L.C.;
RT   ;
RL   Submitted (14-MAR-2005) to the EMBL/GenBank/DDBJ databases.
RL   Ciencia y Tecnologia, Universidad Nacional de Quilmes, Roque Saenz Pena
RL   180, Bernal, Buenos Aires 1876, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .557
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="C315-14"
FT                   /mol_type="genomic RNA"
FT                   /country="Argentina"
FT                   /clone="C9"
FT                   /db_xref="taxon:12162"
FT   CDS             6. .554
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="AAY29159.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMNSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMASSHISFESVMRTELKLVVRAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
XX
SQ   Sequence 557 BP; 144 A; 113 C; 133 G; 167 T; 0 other;

ay962327 Length: 557  31-MAR-2006  Type: N  Check: 3072  ..

       1  acaatatgcg agcttacttt agtgttaacg attacataag ccttttggct
      51  aaggtcggcg cagttgtgga acgtttgtgc gatcccagcg taactctcac
     101  ggaagtgatg gacgaaatta acgattttaa ctcgtttctc gctttagtac
     151  actctatgaa ctcagacatg aacggtgatc atcaggatgg tcaccatgag
     201  atgggtgaac acaagtctcg attgttgtgc aatatagagg cgaaactacg
     251  aatacttctc gacatcataa gacgtcggtt tactcgcgac aagctgctct
     301  gtactagcgc aacagacgtc atgggcttct tcgttatgag gtacatggct
     351  tctagtcaca tcagttttga atccgtaatg cgaacggagc tgaaattagt
     401  agttagagca gtactatcgg atttatcccg cgcgcataaa ctagatttta
     451  gcgagcgagc ctttgcggct tacggtatcc ttttacaaaa gggtactgta
     501  gcgactgttt gtggtcagtt tgacattaat ttagtttctc catcttgcgt
     551  gtaggtt