Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate C315-14 clone C6 p20 gene, complete cds.

ACC No: AY962333

Dated: 2006-03-31 | Length: 557 | CRC: 1471149843

                
ID   AY962333   standard; genomic RNA; VRL; 557 BP.
XX
AC   AY962333;
XX
SV   AY962333.1
XX
DT   31-MAR-2006 (Rel. 87, Created)
DT   31-MAR-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate C315-14 clone C6 p20 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-557
RA   Iglesias N.G., Marengo J.M., Riquelme K.L., Costa N.B., Plata M.I.,
RA   Semorile L.C.;
RT   "Characterization of the population structure in a grapefruit isolate of
RT   Citrus tristeza virus (CTV) selected for pre-immunization assays in
RT   Argentina";
RL   Unpublished.
XX
RN   [2]
RP   1-557
RA   Iglesias N.G., Marengo J.M., Riquelme K.L., Costa N.B., Plata M.I.,
RA   Semorile L.C.;
RT   ;
RL   Submitted (14-MAR-2005) to the EMBL/GenBank/DDBJ databases.
RL   Ciencia y Tecnologia, Universidad Nacional de Quilmes, Roque Saenz Pena
RL   180, Bernal, Buenos Aires 1876, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .557
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="C315-14"
FT                   /mol_type="genomic RNA"
FT                   /country="Argentina"
FT                   /clone="C6"
FT                   /db_xref="taxon:12162"
FT   CDS             6. .554
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="AAY29165.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSATD
FT                   VMGFFVVRYMSSSHTSFESVMHTELKLVVKAVLSDLSRTHKLDFSERAFAAYGILLQKG
FT                   AVATVCSQFDINLVSPSCV"
XX
SQ   Sequence 557 BP; 137 A; 116 C; 142 G; 162 T; 0 other;

ay962333 Length: 557  31-MAR-2006  Type: N  Check: 2870  ..

       1  acaatatgcg agcttacttt agtgttaacg attacataag ccttttggct
      51  aaggttggcg cagttgtgga acgtttatgc gatcccagcg taactctcac
     101  ggaagtgatg gacgaaatta atgactttaa ctcgttcctc gctttggtgc
     151  actctatgaa gtcggacatg aacggagatc atcaggatgg tcaccatgag
     201  atgggtgaac acaagtctcg gttgttgtgc aacatagagg cgaaactgcg
     251  agtacttctc gacatcataa gacgtcggtt cactcgcgaa aaactgctct
     301  gtaccagtgc tacggatgtc atgggcttct tcgtcgtgag gtacatgagt
     351  tctagtcaca ccagtttcga gtccgtaatg cacacggaat tgaagttagt
     401  ggttaaggcg gtgctgtcag atttatcccg cacgcataaa ctagatttta
     451  gcgagcgagc ctttgcggct tacggtatcc ttttacaaaa gggtgccgtg
     501  gcaaccgttt gtagtcagtt tgacattaat ttagtttctc catcttgcgt
     551  gtaggtt