Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate C315-16 p20 gene, complete cds.

ACC No: AY962338

Dated: 2005-09-30 | Length: 557 | CRC: 624723589

                !!NA_SEQUENCE 1.0
ID   AY962338   standard; genomic RNA; VRL; 557 BP.
XX
AC   AY962338;
XX
SV   AY962338.1
XX
DT   30-SEP-2005 (Rel. 85, Created)
DT   30-SEP-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate C315-16 p20 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-557
RA   Iglesias N.G., Riquelme K., Marengo J.M., Costa N.B., Plata M.I.,
RA   Semorile L.C.;
RT   "Genetic structure of Citrus tristeza virus (CTV) populations from field
RT   Argentinian isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-557
RA   Iglesias N.G., Riquelme K., Marengo J.M., Semorile L.C.;
RT   ;
RL   Submitted (14-MAR-2005) to the EMBL/GenBank/DDBJ databases.
RL   Ciencia y Tecnologia, Universidad Nacional de Quilmes, Roque Saenz Pena
RL   180, Bernal, Buenos Aires 1876, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .557
FT                   /country="Argentina"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="C315-16"
FT   CDS             6. .554
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="AAY29170.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMASSHISFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
XX
SQ   Sequence 557 BP; 144 A; 112 C; 135 G; 166 T; 0 other;

 AY962338  Length: 557  October 4, 2005 08:49  Type: N  Check: 2388  ..

       1  acaatatgcg agcttacttt agtgttaacg attacataag ccttttggct
      51  aaggtcggcg cagttgtgga acgtttgtgc gatcccagcg taactctcac
     101  ggaagtgatg gacgaaatta atgattttaa ctcgtttctc gctttagtac
     151  actctatgaa gtcagacatg aacggtgatc atcaggatgg tcaccatgag
     201  atgggtgagc acaaatctcg attgttgtgc aatatagagg cgaaactgcg
     251  aatacttctc gacatcataa gacgtcggtt tactcgcgac aagctgctct
     301  gtaccagcgc aacagacgtg atgggcttct tcgttatgag gtacatggct
     351  tctagtcaca tcagttttga atccgtaatg cgaacggagc tgaaattagt
     401  agttaaagca gtactatcgg atttatcccg cgcgcataaa ctagatttta
     451  gcgagcgagc ctttgcggct tacggtatcc ttttacaaaa gggtactgta
     501  gcgaccgttt gtggtcagtt tgacattaat ttagtttctc catcttgcgt
     551  gtaggtt