Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate C315-14 clone J4 p23 gene, complete cds.

ACC No: AY962351

Dated: 2006-03-31 | Length: 633 | CRC: -1154339492

                
ID   AY962351   standard; genomic RNA; VRL; 633 BP.
XX
AC   AY962351;
XX
SV   AY962351.1
XX
DT   31-MAR-2006 (Rel. 87, Created)
DT   31-MAR-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate C315-14 clone J4 p23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RA   Iglesias N.G., Marengo J.M., Riquelme K.L., Costa N.B., Plata M.I.,
RA   Semorile L.C.;
RT   "Characterization of the population structure in a grapefruit isolate of
RT   Citrus tristeza virus (CTV) selected for pre-immunization assays in
RT   Argentina";
RL   Unpublished.
XX
RN   [2]
RP   1-633
RA   Iglesias N.G., Marengo J.M., Riquelme K.L., Costa N.B., Plata M.I.,
RA   Semorile L.C.;
RT   ;
RL   Submitted (14-MAR-2005) to the EMBL/GenBank/DDBJ databases.
RL   Ciencia y Tecnologia, Universidad Nacional de Quilmes, Roque Saenz Pena
RL   180, Bernal, Buenos Aires 1876, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="C315-14"
FT                   /mol_type="genomic RNA"
FT                   /country="Argentina"
FT                   /clone="J4"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AAY29183.1"
FT                   /translation="MDDTSGQTFVSMNLSDESNTASTAVRTVSSEADRLEFLRKMNPFI
FT                   IDALVRKTNYQGARFRAKIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKGKARAFSNAEMFAIDLVMYTKEKQLAVNLAAEREKTRLARRHPMRSPEETPEF
FT                   YKFGITAKAMLPNINAVDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 633 BP; 193 A; 123 C; 157 G; 160 T; 0 other;

ay962351 Length: 633  31-MAR-2006  Type: N  Check: 1958  ..

       1  atggatgata ctagcggaca aactttcgtt tctatgaacc tttctgacga
      51  aagcaacaca gcaagtactg cagttagaac cgtaagttcg gaagctgatc
     101  gcttggaatt tttacgaaaa atgaacccct ttatcatcga cgctttggta
     151  cggaaaacca attatcaggg tgctcgcttt cgcgcaaaaa taataggagt
     201  atgcgtagat tgtggtagaa aacacgataa ggggttgaag accgaacgta
     251  aatgtaaggt caataataca cagtctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgttaagta tttaaataaa ggaaaggcta gagccttttc
     351  taacgcagag atgtttgcaa tcgatttggt tatgtacacc aaggaaaagc
     401  agttggcggt taatttggcc gctgaaaggg agaagacgag actggctcgt
     451  agacacccga tgcgttctcc ggaagaaact ccggaattct ataaattcgg
     501  tataactgct aaagcaatgt taccgaacat caacgctgtg gacgttggtg
     551  ataacgagga cacttcgtcg gagtacccag tgagtctgag tgtttctggc
     601  ggagttctcc gtgaacacca cttcatctga ttg