Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate C315-14 clone J48 p23 gene, complete cds.

ACC No: AY962380

Dated: 2006-03-31 | Length: 633 | CRC: 520261603

                
ID   AY962380   standard; genomic RNA; VRL; 633 BP.
XX
AC   AY962380;
XX
SV   AY962380.1
XX
DT   31-MAR-2006 (Rel. 87, Created)
DT   31-MAR-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate C315-14 clone J48 p23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RA   Iglesias N.G., Marengo J.M., Riquelme K.L., Costa N.B., Plata M.I.,
RA   Semorile L.C.;
RT   "Characterization of the population structure in a grapefruit isolate of
RT   Citrus tristeza virus (CTV) selected for pre-immunization assays in
RT   Argentina";
RL   Unpublished.
XX
RN   [2]
RP   1-633
RA   Iglesias N.G., Marengo J.M., Riquelme K.L., Costa N.B., Plata M.I.,
RA   Semorile L.C.;
RT   ;
RL   Submitted (14-MAR-2005) to the EMBL/GenBank/DDBJ databases.
RL   Ciencia y Tecnologia, Universidad Nacional de Quilmes, Roque Saenz Pena
RL   180, Bernal, Buenos Aires 1876, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="C315-14"
FT                   /mol_type="genomic RNA"
FT                   /country="Argentina"
FT                   /clone="J48"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AAY29212.1"
FT                   /translation="MDDTSGQTFVSVNLSDESNTASTRVENVKSEADRLEFLRKMNPLI
FT                   IDALVRKTNYQGARFRARIIGVCVDCDKKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAKMFAIELVLYTKEKQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINIVDVGDNEDTSSEYPVSLRVSGGVLREHHFI"
XX
SQ   Sequence 633 BP; 196 A; 126 C; 158 G; 153 T; 0 other;

ay962380 Length: 633  31-MAR-2006  Type: N  Check: 6662  ..

       1  atggatgata ctagcggaca aactttcgtt tctgtgaacc tttctgacga
      51  aagcaacaca gcgagcacta gagttgaaaa cgtaaaatcg gaagcggatc
     101  gcctggagtt tttacgtaaa atgaatccct taattattga cgctctggtg
     151  cggaaaacca attatcaggg cgctcgcttt cgtgcgagaa taataggagt
     201  atgcgtggat tgtgataaaa aacacgacaa ggcgctcaag actgaacgta
     251  agtgtaaggt caacaatacg cagtctcaga acgaggtggc gcatatgttg
     301  atgcacgatc ccgttaaata tttaaacaaa agaaaggcta gagccttttc
     351  taacgcaaag atgtttgcga ttgaattggt tttgtacacc aaggaaaagc
     401  aattggcggt tgatttggcc gccgaaaggg agaagacgag gttagctcgt
     451  agacacccaa tgcgttctcc agaggaaact ccggaacatt ataaattcgg
     501  tatgactgct aaagcaatgt taccggacat caacatcgta gacgttggtg
     551  acaacgaaga cacttcgtcg gagtacccag taagtctgag agtttctggc
     601  ggagttctcc gtgaacacca cttcatctga ttg