Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate C315-14 clone J53 p23 gene, complete cds.

ACC No: AY962385

Dated: 2006-03-31 | Length: 633 | CRC: -740842059

                
ID   AY962385   standard; genomic RNA; VRL; 633 BP.
XX
AC   AY962385;
XX
SV   AY962385.1
XX
DT   31-MAR-2006 (Rel. 87, Created)
DT   31-MAR-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate C315-14 clone J53 p23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RA   Iglesias N.G., Marengo J.M., Riquelme K.L., Costa N.B., Plata M.I.,
RA   Semorile L.C.;
RT   "Characterization of the population structure in a grapefruit isolate of
RT   Citrus tristeza virus (CTV) selected for pre-immunization assays in
RT   Argentina";
RL   Unpublished.
XX
RN   [2]
RP   1-633
RA   Iglesias N.G., Marengo J.M., Riquelme K.L., Costa N.B., Plata M.I.,
RA   Semorile L.C.;
RT   ;
RL   Submitted (14-MAR-2005) to the EMBL/GenBank/DDBJ databases.
RL   Ciencia y Tecnologia, Universidad Nacional de Quilmes, Roque Saenz Pena
RL   180, Bernal, Buenos Aires 1876, Argentina
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="C315-14"
FT                   /mol_type="genomic RNA"
FT                   /country="Argentina"
FT                   /clone="J53"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AAY29217.1"
FT                   /translation="MDDTSGQTLISVNLSDESNTASTEVKTVSSEAERLEFLRKMNPFV
FT                   IDALIRKTSYQGARFRARIIGVCVDCGKKHEKGSRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VEYLSKRKARAFSNAEMFAIDLVMYTKERQLAVDLAAEREKTRLARKHSMRSPEETPEH
FT                   YKFGMTAKAMLPDINIVDVGDNENTSSEYPVSLRVSGGVLREHHFI"
XX
SQ   Sequence 633 BP; 193 A; 123 C; 161 G; 156 T; 0 other;

ay962385 Length: 633  31-MAR-2006  Type: N  Check: 7585  ..

       1  atggatgata ctagcggaca aactctcatt tccgtgaacc tttctgacga
      51  aagcaacacg gctagtactg aagttaaaac cgtaagttct gaagcggagc
     101  gcttggaatt tttacggaaa atgaatccct ttgttattga tgctttgata
     151  cggaaaacca gttatcaggg tgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtaaaa aacacgaaaa ggggtcgagg actgaacgta
     251  agtgtaaggt caacaacaca cagtctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgttgagta tttaagtaag agaaaagcta gagccttttc
     351  taacgcggag atgtttgcga tcgatttggt tatgtacacc aaagaaaggc
     401  aattagcggt tgatttggcc gccgaaaggg aaaagacgag actggctcgt
     451  aaacactcaa tgcgttctcc ggaagaaact ccggaacatt ataaattcgg
     501  tatgactgct aaagcaatgt taccggacat caacatcgta gacgttggtg
     551  acaacgaaaa cacttcgtcg gagtacccag taagtctgag agtttctggc
     601  ggagttctcc gtgaacacca cttcatctga ttg