Sequence of DPV Wuhan nodavirus

Pieris rapae virus RNA-dependent RNA polymerase gene, complete cds.

ACC No: AY962576

Dated: 2006-07-08 | Length: 3149 | CRC: -1601006539

                
ID   AY962576; SV 1; linear; genomic RNA; STD; VRL; 3149 BP.
XX
AC   AY962576;
XX
DT   01-OCT-2005 (Rel. 85, Created)
DT   08-JUL-2006 (Rel. 88, Last updated, Version 2)
XX
DE   Pieris rapae virus RNA-dependent RNA polymerase gene, complete cds.
XX
KW   .
XX
OS   Pieris rapae virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Nodaviridae;
OC   unclassified Nodaviridae.
XX
RN   [1]
RP   1-3149
RX   DOI; 10.1016/j.virusres.2005.09.003.
RX   PUBMED; 16780981.
RA   Liu C., Zhang J., Yi F., Wang J., Wang X., Jiang H., Xu J., Hu Y.;
RT   "Isolation and RNA1 nucleotide sequence determination of a new insect
RT   nodavirus from Pieris rapae larvae in Wuhan city, China";
RL   Virus Res. 120(1-2):28-35(2006).
XX
RN   [2]
RP   1-3149
RA   Liu C., Zhang J., Yi F., Wang J., Wang X., Hu Y.;
RT   ;
RL   Submitted (15-MAR-2005) to the EMBL/GenBank/DDBJ databases.
RL   Life Science, Microbiology, Luojiashan, Wuhan, Hubei 430072, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3149
FT                   /organism="Pieris rapae virus"
FT                   /segment="RNA1"
FT                   /host="Pieris rapae"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /isolation_source="insect larvae"
FT                   /db_xref="taxon:327392"
FT   CDS             34. .3078
FT                   /codon_start=1
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="protein A; non-structural protein"
FT                   /db_xref="GOA:Q3KSM3"
FT                   /db_xref="InterPro:IPR001205"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KSM3"
FT                   /protein_id="AAY27743.1"
FT                   /translation="MSSVIKTIVVKTLQCTVKCVCVGVRQQYGLLRRHPKTIACALVGG
FT                   IIAHDVLHLYAAVYRVENPWEFVPTEGPRGVIVLRVYNALRFTAAKWRWNCWTIFGKFP
FT                   FNSEQFSRIMETSTERKPDLRPLLVPAHETIEVYPCNNIHSHPRSAEFRSSANEYLVRS
FT                   VRRAGYPPYVVSSSKRDFCDGNRFFYCPKDFGMQFRNDPISNNHALVFTDVDYYANMNR
FT                   WLQLFLPTCLYTLVPTRLNYSNDEFAYRFENNEIVYNVTGGGEYRHSLWDYKGDTVTVV
FT                   DEYGNLLIFDIEQRRVQGDEQHRLIWLLPKAKITDPLWIVGPTEWYDKLLVRKTVQQGR
FT                   LKILWEPIADDLSIGLHGSNYSVSLKGELFEAIRTRISCKDSTPYVSDVERMLREAKHK
FT                   NFLTDAPILYHCFQDDVIIRPNVVKTGSFPVTYNAIPKKAPSVTEDPKMPGQVVTTPLV
FT                   SQPALFAGKGFNADKACIEGRIEKVRNVTKFPIKYVRYAAEFVKLVIPETIAGTGVPNS
FT                   IGMIREEQDKVAQRARFDRVAPIMSTQTENSIKAFIKTEMYAAAKAPRNISTMAPEITI
FT                   QSSAYSLPMAKIFKKIPWYCPGKNPKEITLRLAEVCLQDPDHELEEGDYTCMDGTQSPD
FT                   YSDLLLLPIYMRYFAKQYRGQFKNLYNQIYKQRATTSSGVPYNPEMTIRSGSSITTHAG
FT                   TLNNAFNIYAALRDMGYDETTAWDKVGAVFGDDSLNANHQGEFHSYIEHVTKVLGMRYK
FT                   SNLRERGQPVLFLGRYFVDPITSYDSFADPMRTIGKLHATANKNVSVEQGAANKAHGYI
FT                   TTDSKTPIIGAWARRVLEITKKKFKNGTGEEQYRCSNAWPQKDEAAIRAAMAAVLEVDE
FT                   AQLIAQNEAVLKVNSLDQFPVVFDTYYDHKQLAEVDGQLVGTDLHIKEEDERQPETSID
FT                   SVPSTGPPPSNGDPNAGGKPTDGPSKGKRKVKGRRPRTAGDPATLRLTDAGSSRRVKPP
FT                   RKLRPEAKRGGRPIETLVFKNSSLS"
XX
SQ   Sequence 3149 BP; 969 A; 726 C; 718 G; 736 T; 0 other;

ay962576 Length: 3149  08-JUL-2006  Type: N  Check: 9993  ..

       1  ataaaacgta acgtgacaaa tataaacagc aagatgagtt cagtaatcaa
      51  gacaatagtc gtaaaaacac tgcaatgcac tgtcaagtgc gtatgcgtgg
     101  gggtacgaca acagtatggg ttactacgca ggcatcctaa gaccattgcc
     151  tgtgcactcg tgggaggtat aattgcccac gatgttctac atttatacgc
     201  cgcagtctac cgggtcgaaa atccttggga attcgtacct acggagggcc
     251  ctagaggcgt catcgtgctt agggtgtaca acgccctacg ttttaccgca
     301  gctaaatggc ggtggaattg ctggactata tttggaaagt tccccttcaa
     351  cagcgaacag ttctcgagaa tcatggaaac cagcacagaa cggaaaccag
     401  acttaagacc attgctcgtg ccagcacacg agacaataga ggtgtaccct
     451  tgtaataaca tacactcaca cccccgttca gcagaatttc gatcctctgc
     501  taatgaatat ctggtccgtt ctgttagacg tgctggttac ccaccatatg
     551  tagtctcatc atcaaaacgt gacttttgcg atggtaaccg tttcttttac
     601  tgcccgaaag acttcggaat gcagtttagg aatgatccaa tatccaacaa
     651  ccatgcatta gtctttactg atgttgacta ctatgctaac atgaaccgat
     701  ggctacaatt gttcttacca acctgcttat acaccttagt accaacacga
     751  ctcaactact caaacgatga gttcgcttac cgttttgaga ataacgagat
     801  agtgtataac gtgacaggtg gcggtgagta tcgacatagc ctatgggatt
     851  ataagggcga cacagtcaca gtcgtcgatg agtacgggaa cttactgata
     901  tttgacattg aacagaggag agtacagggt gatgagcaac accggttaat
     951  ctggttgttg cctaaagcta aaatcaccga ccccctctgg atcgtcggac
    1001  ccacagaatg gtatgacaag ctactagtac gtaagaccgt tcagcagggc
    1051  cggcttaaaa tactctggga gcctattgcc gatgatctga gcataggact
    1101  tcacgggtca aattattcag tgtcattaaa gggtgaatta ttcgaagcaa
    1151  tcaggactcg cattagctgt aaagacagca caccttatgt ttctgatgtt
    1201  gagcgtatgc tacgtgaggc taagcataaa aactttctca cagatgcacc
    1251  gatactctac cattgtttcc aagatgacgt cataataaga ccaaacgttg
    1301  ttaaaactgg tagtttcccg gtcacctaca atgcaatacc taagaaagct
    1351  ccatctgtaa ctgaggatcc gaaaatgcct ggccaggttg taacgacacc
    1401  actagtttca caaccagcct tgtttgctgg aaaaggcttc aatgccgaca
    1451  aagcttgcat agaaggacgt atcgagaaag tacggaatgt aacaaagttt
    1501  ccgattaagt acgtgcgtta tgcagcagaa tttgtgaagc tagttatacc
    1551  tgagaccatt gctggaactg gtgtaccgaa ctccatcggg atgatacggg
    1601  aggaacaaga taaagtcgcc caaagagccc gatttgacag agttgcacca
    1651  ataatgtcta ctcagactga aaatagtatt aaagcgttca tcaaaacaga
    1701  gatgtacgca gctgccaaag ctccacgcaa catatcaaca atggcacctg
    1751  agattactat acagtcgtca gcgtacagtc ttccaatggc taagatattc
    1801  aagaaaatac cttggtattg cccggggaag aacccgaaag agataacctt
    1851  acggttagcc gaggtttgtt tgcaagaccc tgatcacgaa ttagaagaag
    1901  gcgattacac gtgtatggat ggcacccaga gtccagatta ttcggaccta
    1951  ttactactgc caatatacat gcgttatttc gcgaagcaat atcgtggcca
    2001  gtttaaaaat ctatataacc aaatatacaa acaacgtgca acaacatcct
    2051  ctggtgtacc gtacaacccc gaaatgacta tacgttcggg aagctctatc
    2101  actacacacg ctggaaccct taataacgca ttcaacattt atgctgcact
    2151  gcgtgatatg gggtacgatg agacaacggc atgggataag gtaggggcag
    2201  tgtttggtga tgatagcctt aacgctaatc accaaggaga gttccatagt
    2251  tacattgaac atgtgacaaa agttcttggt atgcgctata agtcaaattt
    2301  gcgcgaacgc ggacaaccag tccttttctt aggacgttac ttcgttgacc
    2351  ctataacctc ttatgattct tttgcagacc ctatgagaac aatcgggaag
    2401  ctgcatgcta cggcaaataa gaatgtcagt gttgaacaag gtgccgctaa
    2451  caaagcacac ggttatataa caactgacag caagacgcca atcataggag
    2501  cttgggctag acgagtactt gaaataacca agaaaaagtt caaaaatgga
    2551  acaggagaag aacaataccg ctgcagcaac gcatggccac agaaagacga
    2601  ggcggccata cgtgcagcaa tggcggcagt tctggaagtc gatgaggcac
    2651  agcttatagc ccaaaatgaa gcagtgctta aagttaacag tcttgaccaa
    2701  tttccagtgg tgtttgacac ctactatgac cacaaacagc ttgcagaagt
    2751  tgatggtcaa ctagttggga cggacttgca tataaaggaa gaagatgaac
    2801  gacaaccaga aacaagcatt gacagcgtac caagcactgg tccgccgcca
    2851  agtaatggcg acccgaacgc tggtggaaaa ccaactgacg gcccttcaaa
    2901  aggcaagcgg aaggttaaag gccgtaggcc tcgaaccgcc ggcgatcccg
    2951  ccacacttcg tctcacggat gctggaagca gccgacgtgt taaaccccct
    3001  cgcaagctac gccccgaagc caagcgggga ggcagaccca tcgaaactct
    3051  agtctttaag aatagttcct taagctagct tagcttcgat ttgtgagagg
    3101  ttcacctttc accacctgtg gagttatctc caccaccaat aaacaggtg