Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Ir. n. 3 minor coat protein gene, complete cds.

ACC No: AY966458

Dated: 2006-08-08 | Length: 878 | CRC: -1707916506

                
ID   AY966458; SV 1; linear; genomic RNA; STD; VRL; 878 BP.
XX
AC   AY966458;
XX
DT   01-MAY-2005 (Rel. 83, Created)
DT   08-AUG-2006 (Rel. 88, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate Ir. n. 3 minor coat protein gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-878
RA   Khatabi B., Alavi S.V., Rastgou M., Salekdeh G.H.;
RT   "Complete sequence of minor coat protein (P27) gene of Iranian isolates of
RT   Citrus tristeza virus";
RL   Unpublished.
XX
RN   [2]
RP   1-878
RA   Khatabi B., Alavi S.V., Rastgou M., Salekdeh G.H.;
RT   ;
RL   Submitted (18-MAR-2005) to the EMBL/GenBank/DDBJ databases.
RL   Proteomics, Agricultural Biotechnology Research Institute of Iran (ABRII),
RL   Mahdasht Road, Karaj, Tehran 31535-1897, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .878
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Ir. n. 3"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran"
FT                   /db_xref="taxon:12162"
FT   CDS             47. .769
FT                   /codon_start=1
FT                   /product="minor coat protein"
FT                   /note="P27"
FT                   /db_xref="GOA:Q52SL4"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q52SL4"
FT                   /protein_id="AAX94042.1"
FT                   /translation="MAGYTMLPKTDDKEMDPVSAAVPGKYPDVIEKFVTNRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEQLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLTGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
XX
SQ   Sequence 878 BP; 260 A; 165 C; 204 G; 249 T; 0 other;

ay966458 Length: 878  08-AUG-2006  Type: N  Check: 6777  ..

       1  atgagcagag acgtggcaac atccggtttt aatttaccct ttcatcatgg
      51  cgggttacac gatgcttccc aaaactgatg acaaagaaat ggacccggtg
     101  agtgccgctg tgcccggtaa atacccggac gttatcgaaa agtttgtgac
     151  caataggtcg gtagatgcgt taatagaagg tgttattagc aagttggata
     201  ccaattcaat atacgaagat tccactgaaa aatttactgg tgagcaattg
     251  aagtacgtca tggttactat ggacactttc ttactagaaa attacaaaac
     301  gaaaacggag gatctgctgg ttcacttggc tatgattcaa aagaggttgt
     351  gcactatatc tacgagtact aaaaccaaat ttcgtgataa aggttgtatc
     401  agttacgtgc aagggggttt acgatataag ttaatggata aagtagtttt
     451  tccctttatt atatctaagt ttactgacag ggagactcca aacgctctac
     501  gtaagtatgc ttgtactttt gaggagttac acttgtgtat ggccaggctg
     551  agacccgact tatacgaaaa caaaaggacg accaaagctg ggactccgca
     601  tttaaaaggc tacttatcag ctgattttct tacgggttcc ctcccaggat
     651  actccgaaca tgaacgaggt atcatccttc gagcgtctga atctatgtta
     701  gctagacgtc aaggttacga ggaggcaacc gagcttctta acttacgcga
     751  tttgggaaag tatttgtagt tagtttgcgg acggtggtat tacgccatcc
     801  catgagcact gctttaaggg tcgttaattg acgactcttg atatttacta
     851  agtttgagtt atggacgacg aaacaaag