Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 464-1 p6, Hsp70h, p61, CPm, CP, p18, p13, p20, and p23 genes, complete cds.

ACC No: AY995565

Dated: 2005-04-26 | Length: 7365 | CRC: 1751106556

                !!NA_SEQUENCE 1.0
ID   AY995565   standard; genomic RNA; VRL; 7365 BP.
XX
AC   AY995565;
XX
SV   AY995565.1
XX
DT   26-APR-2005 (Rel. 83, Created)
DT   26-APR-2005 (Rel. 83, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate 464-1 p6, Hsp70h, p61, CPm, CP, p18, p13,
DE   p20, and p23 genes, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-7365
RA   Roy G., Yokomi R.K., Ullman D.E.;
RT   "Amino acid sequence variations associated with aphid transmissibility of
RT   Citrus tristeza virus";
RL   Unpublished.
XX
RN   [2]
RP   1-7365
RA   Roy G., Yokomi R.K., Ullman D.E.;
RT   ;
RL   Submitted (31-MAR-2005) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, University of California at Davis, One Shields Avenue,
RL   Davis, CA 95616, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7365
FT                   /country="USA:Tulare county, California"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="464-1"
FT                   /isolation_source="aphid transmission during 2000 from a
FT                   naturally infected field tree"
FT   CDS             12. .167
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="AAY15713.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNTSPY
FT                   GTHATV"
FT   CDS             173. .1957
FT                   /codon_start=1
FT                   /note="p65; similar to heat shock protein 70"
FT                   /product="Hsp70h"
FT                   /protein_id="AAY15714.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTAKNYQTYLHKLSPSYKVMVEEFGTKSVP
FT                   VPYLSPLNNDLGLSVALPLLIASYAKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSISMSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDKKLSDKIYEMADFIPQKELNVSSLKEALSLQTDPVKYTVTHHG
FT                   MSETISIDQTALREIASVFINRTIDILTQVKAKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LATVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSRYDYTGMPHPTRNLVKLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDTLLADLRRTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             1881. .3488
FT                   /codon_start=1
FT                   /product="p61"
FT                   /protein_id="AAY15715.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRSFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSLMTGIEDRKVPDELISV
FT                   DPHEVGCRFTLNDVESYLISRGEDSADVTAVEHSWCLSNSCGRLLSSTEIDAYKTLVFT
FT                   KNFDSNVSGVTTKLETYLSYCISLYKKHCMKDDDYFNLITPMFNCLVKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLKNKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   VLIPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLEYVVESDALDDLSQHVDIRLAADNPD
FT                   LRVDLRWAGMFVYYGVYRCAIDRVVERPTLFRLPQKLLSQDDGESCSLRMSAVEALFNL
FT                   VQKVNRDINVRRQFMGRHSKVALRLYRNLGLRFPPISSVRLPVHHGYLYVDFYKRVPDD
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSFRTFRGRGARGASSRHMSRD
FT                   VATSGFNLPYHGRLYNTS"
FT   CDS             3463. .4185
FT                   /codon_start=1
FT                   /note="minor capsid protein; p27"
FT                   /product="CPm"
FT                   /protein_id="AAY15716.1"
FT                   /translation="MAGYTTLPNTDDKEMNPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEHLKYVMVTMDAFLLENYKTKTEDLLVHLAMIQKRLCTT
FT                   STSTKTKFRDKGCISYVQGGSRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             4282. .4953
FT                   /codon_start=1
FT                   /note="capsid protein; p25"
FT                   /product="CP"
FT                   /protein_id="AAY15717.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             4919. .5422
FT                   /codon_start=1
FT                   /product="p18"
FT                   /protein_id="AAY15718.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPNE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVIMGANVDDSRCGCSIWFYNNGTFQNGLTRCNNLVTL
FT                   FSAT"
FT   CDS             5456. .5815
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="AAY15719.1"
FT                   /translation="MSIRRVWLKVIAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYDLANFDLDFLRIVIIPLSGGTANESRSDRTNVSEIVESHVSDRDRMHILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             5891. .6439
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="AAY15720.1"
FT                   /translation="MRAYFSVNDYISLLAKVGSVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSATD
FT                   VVGFFVVRYMSSSHTSFETVMRTELKLVVKAVLSELSRTHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
FT   CDS             6522. .7151
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AAY15721.1"
FT                   /translation="MDDTSGQTFVSVNLSDESNTASTKVENVKSEADRLEFLRKMNPFI
FT                   IDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVLYTKERQLAVDLAAEREKTRLARRHPIRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 7365 BP; 2002 A; 1382 C; 1785 G; 2196 T; 0 other;

  AY995565  Length: 7365  May 3, 2005 09:01  Type: N  Check: 2728  ..

       1  acggggtttc aatggactgt gtgattcaag gatttttgac ttttctggtt
      51  ggtatagctg tgttttcggc ctttgccgga ctgattatca ttgttataac
     101  gatttatcgg tgcacgacta agcctgttag gaacacttct ccttacggca
     151  ctcacgccac tgtctaagcg gtatggtact tctgggttta gactttggta
     201  ccacgttttc gacggtggct atggctacat cctctgagtt agttatactc
     251  aaacaatcta attcatcgta catacctaca tgtttgtttt tgcatgcaga
     301  ccctaacagc gtgtcttatg gttacgatgc ggaatattta gcggcttctg
     351  gggagcctgg ttctttttac aaagatttga aacggtgggt tggttgcact
     401  gcgaagaact accaaaccta cttacacaaa ctatcgcctt cctataaggt
     451  gatggtggaa gagtttggaa ctaagagtgt gccagtccca tatttgtcac
     501  ctctgaataa cgatttggga ctcagtgtcg ctttaccttt actaatcgct
     551  tcgtatgcca aatccatttt gtcggatgcg gaacgagtgt tcaatgtaag
     601  ctgcactgga gttatatgtt cggtacccgc tggttataac acgttgcaac
     651  gagcttttac gcagcagagt atatcgatgt cgggttactc ttgcgtgtac
     701  attattaacg aaccttcagc agccgcgtac tccactttac ctaagttgag
     751  ttcggcagat aaatatttag ccgtttacga cttcggcggt gggactttcg
     801  acgtctctat agttagcgtc agattgccta cgttcgccgt taggagttcg
     851  ggtggtgaca tgaatttagg tggtagagat atcgacaaaa agttatctga
     901  taaaatatac gaaatggcag attttatacc gcaaaaggaa ttgaacgttt
     951  ctagtttaaa ggaagcttta tctcttcaaa ctgatccggt caaatatact
    1001  gtaactcatc acggaatgag tgagacgata tcaattgatc aaacggcgtt
    1051  gagggagata gcttcggtgt tcataaatcg aacgatagat atacttacgc
    1101  aagttaaagc taagtctagt atgcccgaat cgcaaagttt aaagttagtg
    1151  gtagtcggtg gaagctcgta cctaccagga ttgttggata ctttggcaac
    1201  cgtgcctttc gtgtctggga tagtaccagt ggaagacgca agaaccgcgg
    1251  tcgctagagg gtgtgcttta tatagtgagt gcttagatgg taggtccaag
    1301  gccctactaa tagattgtat tacacatcat ttgtcggtta cgacgtttag
    1351  cgcggactcg gtcgttgtcg cagcggccgg tagtccaatt ccttttgaag
    1401  gagaacgaaa actcacgtta cgcaaatgcg ttagcacgtc taactatcaa
    1451  gcaagaatgt tcgaaggaga ttacgaaaag gttttccgaa atgaacgtat
    1501  ctacgcagct tcagtatcgt tgtttacttt aggagttaat tggcgtgtgc
    1551  ctaacgacgt tgagatgact ctcgtgacca aagtggactc aatgggtaaa
    1601  gtggaatttt accttaaagg tccatctggt gaactagtca acgtgcaagg
    1651  tacttcgcgt tacgattata ctggtatgcc tcaccccact agaaatttgg
    1701  tgaagcttag cgattacaat gtaaactccg ccgctttagt tttagctttg
    1751  acattaactc gcgaaaaacg agaaaagttt cttttgcgga cattatttga
    1801  cactttacta gcagatttgc gaaggacagc aagtttaagc gagtactcaa
    1851  agaagtaccc gatcactcga aacgatatcg atgtcgtctc atcacgtatg
    1901  gggatcgttg tttcgaaagt tttacgggga agcgatttgg aaagaatacc
    1951  tctctgaatc aactcgaagt tttgatgaaa gaaacgtgtc gttggaccac
    2001  actttgagtt cgggtgtggt cgtccgtagg cagagtcttt tgaatgcgcc
    2051  tcaagggact ttcgagaacg agttagcgct attgtataat tcggtggtga
    2101  ttaacgattt tgttgagttg actggtatgc cattgaagtc tttgatgaca
    2151  ggtatcgagg accgtaaggt gcctgacgaa ttaatatccg ttgacccgca
    2201  cgaagtcgga tgtagattca cgttaaacga cgtggaatca tatctaataa
    2251  gcaggggtga ggattccgct gatgtaacgg cggtcgagca ttcgtggtgt
    2301  ttgagtaact cttgtggtag actattaagt tcgaccgaga tagatgctta
    2351  caaaaccttg gtgtttacca agaattttga tagtaatgta tctggagtga
    2401  ctactaagtt agagacttat ctatcgtact gtatatcttt gtacaagaaa
    2451  cactgcatga aagacgatga ttattttaat cttatcacac ctatgtttaa
    2501  ttgtttggtg aaagtgctgg cgtcacttgg tttgttttat gagaaacata
    2551  ctgacaatcc gctactgacc ggaatgctta tagagttttg cctaaaaaat
    2601  aaggtgtatt actctacttt taaagtaaat ctagacaacg ttagattgtt
    2651  taagtctaaa gtgttgcctg tggtgttaac ggtttgggat atatctgagc
    2701  ctgatgaccc agtggatgaa agggtgctaa ttcctttcga tcctactgat
    2751  ttcgtgctcg atttacctaa attgaatata cacgacacaa tggtggtggt
    2801  gggtaatcaa atcagacagt tagagtacgt agtcgagagc gatgctttag
    2851  acgatttatc tcaacacgtt gacatacgtt tagcagcgga caaccccgat
    2901  ctacgcgttg atctgcgttg ggcagggatg tttgtctact acggtgttta
    2951  tcggtgtgct attgatagag tggtagaacg accgacgtta tttagattgc
    3001  cgcagaagtt attgagtcag gatgatggcg aatcgtgctc attgcgcatg
    3051  agtgccgtcg aagctttatt taatctagtg caaaaggtga acagggacat
    3101  aaacgttaga cgtcagttca tgggacgtca cagtaaagtg gctttgcgac
    3151  tgtatcgcaa cttaggtttg aggtttccac cgatctcttc agttaggtta
    3201  ccggttcatc acggttactt atacgtcgat ttttacaaaa gagtacctga
    3251  cgatgctgtt actgccgacg aactcgaaag tttacgtcaa ttacgttcgt
    3301  ccgtggacgt tatgtgtaag gacagggtgt caatcacacc tccaccattc
    3351  aatcgactta gaagaggttc ttttagaaca tttagaggtc gaggcgcacg
    3401  cggtgcgagc tcgcgtcata tgagcagaga cgtggcaact tccggtttta
    3451  atttacctta tcatggcagg ttatacaaca cttcctaata ccgatgacaa
    3501  agaaatgaat ccggtgagtg ccgctgtacc cggtaagtat ccggatgtca
    3551  ttgaaaaatt tgtggccaac aggtccgtag acgcgttaat agaaggcgtc
    3601  ataagtaagt tggataccaa ttcaatatac gaagattcca ctgaaaaatt
    3651  tactggtgaa cacttgaaat acgttatggt tactatggat gctttcttat
    3701  tagaaaacta caagacgaaa acggaagatc tgttggttca cttagctatg
    3751  atccaaaaga ggttgtgcac tacatccacg agcactaaaa ccaagttccg
    3801  cgataaaggt tgtattagtt acgtgcaagg gggttcgcga tataagttaa
    3851  tggataaagt agtttttcct ttcattatat cgaaatttac cgacagggag
    3901  actccgaacg ctctacgtaa gtatgcttgc actttcgagg agttacactt
    3951  gtgtatggct aggttgagac ccgacttata cgaaaataaa aggacgacta
    4001  aagccgggac tccacattta aagggctatt tatcagccga ctttctttcg
    4051  ggttctctcc cagggtactc cgaacatgaa cgaggcatca ttcttcgagc
    4101  gtctgagtct atgttagcta gacgtcaagg ttacgaggag gcaaccgagc
    4151  ttcttaacct acgtgatttg ggtaagtact tgtagttggt ttggggacgg
    4201  taatattatt ataccatccc ttgagcgctg ctttaagggt cgttaattga
    4251  cgactcttga tatatttact aggtttgaat tatggacgac gaaacaaaga
    4301  aattgaagaa caaaaacaag gaaacgaaag aaggcgacga tgttgttgct
    4351  gctgagtctt ctttcggttc cgtaaactta cacatcgatc cgactctgat
    4401  aacgatgaac gatgtgcgtc agttgagtac tcaacagaat gctgctttga
    4451  acagggactt atttcttgct ctgaaaggga agtatcctaa cttgcctgac
    4501  aaagataagg actttcacat agctatgatg ttataccgtt tagcggttaa
    4551  gagttcatca ttgcaaagtg atgatgacac cacgggcata acgtacactc
    4601  gggagggtgt tgaagtagat ttgtctgaca aactttggac cgacatcgtg
    4651  tataattcta agggtattgg taaccgaact aacgcccttc gagtctgggg
    4701  tagaactaac gatgctcttt acttagcctt ttgtagacag aaccgcaatt
    4751  tgagttatgg cggacgtccg ctagatgcag ggattccggc tgggtatcat
    4801  tatttgtgtg cagatttctt gaccggagct ggcttgactg atttagaatg
    4851  tgctgtgtac atacaagcta aagaacaatt gttgaaaaag cgaggggctg
    4901  atgaggttgt agttactaat gtcaggcagc ttgggaaatt taacacacgt
    4951  tgatctattg cgttccgatt cccggtttct atcgggatgg tggagtttca
    5001  tcgtgaacgt gggtgatata attgtccggt tcgcgttaca cgttcctaat
    5051  gaagatatgc tgaatagttt ttcagctata tcgaattgta cgattatagc
    5101  ggatggtagt gctttactaa aggacaatac tgtggttgac cgtttagaaa
    5151  gcatgaatcc tttggcttat ttgttaaaat tagcgaaaac gactactact
    5201  atttgtttta ctatgtccaa taaggttctt tttggtacta ccaaatccga
    5251  accacttagt tgtttagcca tcacgtcgga tcgagtttta ttcaaagtta
    5301  ttatgggcgc taacgttgat gattctcgat gcggctgcag tatttggttt
    5351  tacaacaatg gtacatttca aaacggattg acccgttgta ataatctcgt
    5401  cactttgttt agcgcgactt agacacgaag tgaccgttcg gatttaattg
    5451  ctgcgatgag tattcgacgc gtgtggttaa aggttatagc tgtaattaca
    5501  gtgttgtggt acggtaagga accttctatt agtgaaggtt acaatgctct
    5551  tatgaatgac gactttaaat ttatcgatac gcatttttct aacgtttctt
    5601  atgctaagaa atgttacgat ttggctaatt tcgatttaga ctttttgcgc
    5651  atcgttatca ttcctttgag tggtggcacg gcgaatgaat cgcgttctga
    5701  tcgcactaac gtttcagaga ttgtcgaatc gcatgtaagc gaccgagaca
    5751  gaatgcacat cttgttgcgt aataagcgga tccagattcc ttcgctctta
    5801  ccttgcgata actagagtct actcagtagt acgtctacta gtataacgta
    5851  ttaaacactt tagtgaggag ttttgtttga atcaaacaat atgcgagctt
    5901  actttagtgt taacgattac ataagccttt tggctaaggt tggttcagtt
    5951  gtggaacgtt tgtgcgatcc cagcgtaact ctcacggaag tgatggacga
    6001  aattaatgat tttaactcgt ttctcgcttt ggtgcactct atgaagtcgg
    6051  acatgaacgg cgatcatcag gatggtcacc atgagatggg tgaacataaa
    6101  tctcggttgt tgtgcaatat agaggcgaaa ctgcgagtgc ttctcgacat
    6151  cataagacgt cggtttactc gcgaaaaact gctctgtacc agtgctacag
    6201  atgttgtggg cttcttcgtc gtgaggtaca tgagttctag tcacactagt
    6251  ttcgaaaccg taatgcgaac ggaactgaag ttggtggtta aagctgtgct
    6301  gtcggaattg tcccgcacgc ataaactaga ttttagcgag cgagcctttg
    6351  cggcttacgg tatccttttg cagaagggca ccgtggcaac cgtttgcggt
    6401  cagtttgaca ttaatttagt ttctccgtct tgcgtgtagg ttaatacgct
    6451  tctcagaacg tatggttgta ttaactaact ttaattcgaa catatttatt
    6501  gtttaaagtc tgtgagttac gatggatgat actagcggac aaactttcgt
    6551  ttctgtgaac ctttctgacg aaagcaacac ggcaagcact aaagttgaaa
    6601  acgtaaaatc ggaagcggat cgcttggagt ttttacgtaa aatgaatccc
    6651  tttattattg acgctctggt gcggaaaacc aattatcagg gtgctcgctt
    6701  tcgcgcaaga ataataggag tgtgcgtgga ttgtggtaga aaacacgaca
    6751  aggcgctcaa gactgaacgt aagtgtaagg tcaacaatac gcaatctcag
    6801  aacgaggtgg cgcatatgtt gatgcacgat cccgttaagt atttgaacaa
    6851  aagaaaggct agagcctttt ctaacgcaga gatgtttgcg attgaattgg
    6901  ttttgtacac caaggaaagg caattggcgg tcgatttagc cgctgaaagg
    6951  gagaagacga gactggctcg tagacaccca atacgttctc cggaagaaac
    7001  tccggaacat tataaattcg gtatgactgc taaggcaatg ttaccggaca
    7051  tcaacgccgt agacgttggt gataacgagg aaacttcgtc ggagtaccca
    7101  gtgagtctga gtgtttctgg cggagttctc cgtgaacacc acttcatctg
    7151  attgaagtgg acggaataag ttccttgcgg aactttaagt cgggttggta
    7201  aaaacccttt atgatggtga tgtatcacta gacaataacc ggatgggtaa
    7251  agtctttaaa atgatcgagg ggaaaattaa ccgtatcctc tcgttggtct
    7301  aagctcccac agagtggtag tggtctcaag tgaggcttaa cgtatgcgtg
    7351  aaccaaagaa gttct