Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 81P p6, Hsp70h, p61, CPm, CP, p18, p13, p20, and p23 genes, complete cds.

ACC No: AY995567

Dated: 2005-04-26 | Length: 7368 | CRC: -560703445

                !!NA_SEQUENCE 1.0
ID   AY995567   standard; genomic RNA; VRL; 7368 BP.
XX
AC   AY995567;
XX
SV   AY995567.1
XX
DT   26-APR-2005 (Rel. 83, Created)
DT   26-APR-2005 (Rel. 83, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate 81P p6, Hsp70h, p61, CPm, CP, p18, p13, p20,
DE   and p23 genes, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-7368
RA   Roy G., Yokomi R.K., Ullman D.E.;
RT   "Amino acid sequence variations associated with aphid transmissibility of
RT   Citrus tristeza virus";
RL   Unpublished.
XX
RN   [2]
RP   1-7368
RA   Roy G., Yokomi R.K., Ullman D.E.;
RT   ;
RL   Submitted (31-MAR-2005) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, University of California at Davis, One Shields Avenue,
RL   Davis, CA 95616, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7368
FT                   /country="USA:near McFarland, California"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="81P"
FT                   /isolation_source="aphid transmission during 2001 from a
FT                   naturally infected field tree which was a Fukumoto navel on
FT                   Troyer rootstock"
FT   CDS             12. .167
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="AAY15731.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNTSSY
FT                   GTHATV"
FT   CDS             173. .1957
FT                   /codon_start=1
FT                   /note="p65; similar to heat shock protein 70"
FT                   /product="Hsp70h"
FT                   /protein_id="AAY15732.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTAKNYQTYLHKLSPSYKVTVEEFGTKSVP
FT                   VPYLSPLNNDLGLNVALPLLIASYAKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSISMSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSVVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDKKLSDKIYEMADFIPQKELNVSSLKEALSLQTDPVKYTVTHHG
FT                   MSETISIDQTALREIASVFINRTIDILTQVKVKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LATVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPKDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSHYDYTGMPHPTRNLVKLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDTLLADLRRTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             1881. .3488
FT                   /codon_start=1
FT                   /product="p61"
FT                   /protein_id="AAY15733.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRSFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSLMTGIEDRKVPDELISV
FT                   DPHEVGCRFTLNDVESYLISRGEDSADVTAVEHSWCLSNSCGRLLSSTEIDAYKTLVFT
FT                   KNFDSNVSGVTTKLETYLSYCISLYKKHCMKDDDYFNLITPMFNCLVKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   VLIPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLEYVVESDALDDLSQHVDIRLAADNPD
FT                   LRVDLRWAGMFVYYGVYRCAIDRVVERPTLFRLPQKLLSQDDGESCSLRMSAVEALFNL
FT                   VQKVNRDINVRRQFMGRHSKVALRLYRNLGLRFPPISSVRLPVHHGYLYVDFYKRVPDD
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSSRTFRGRGARGASSRHMSRD
FT                   VATSGFNLPYHGRLYNTS"
FT   CDS             3463. .4185
FT                   /codon_start=1
FT                   /note="minor capsid protein; p27"
FT                   /product="CPm"
FT                   /protein_id="AAY15734.1"
FT                   /translation="MAGYTTLPNTDDKEMNPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEHLKYVMVTMDAFLLENYKTKTEDLLVHLAMIQKRLCTT
FT                   STSTKTKFRDKGCISYVQGGSRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             4285. .4956
FT                   /codon_start=1
FT                   /note="capsid protein; p25"
FT                   /product="CP"
FT                   /protein_id="AAY15735.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             4922. .5425
FT                   /codon_start=1
FT                   /product="p18"
FT                   /protein_id="AAY15736.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPNE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVIMGANVDDSRCGCSIWFYNNGTFQNGLTRCNNLVTL
FT                   FSAT"
FT   CDS             5459. .5818
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="AAY15737.1"
FT                   /translation="MSIRRVWLKVIAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYDLANFDLDFLRIVIIPLSGGTANESRSDRTNVSEIVESHVSDRDRMHILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             5894. .6442
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="AAY15738.1"
FT                   /translation="MRAYFSVNDYISLLAKVGSVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSATD
FT                   VVGFFVVRYMSSSHTSFETVMRTELKLVVKAVLSELSRTHKLDFSERAFTAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
FT   CDS             6525. .7154
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AAY15739.1"
FT                   /translation="MDDTSGQTFVSVNLSDESNTASTKVENVKSEADRLEFLRKMNPFI
FT                   IDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVLYTKERQLAVDLAAEREKTRLARRHPIRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 7368 BP; 2005 A; 1381 C; 1784 G; 2198 T; 0 other;

  AY995567  Length: 7368  May 3, 2005 09:01  Type: N  Check: 3870  ..

       1  acggggtttc aatggactgt gtgattcaag gatttttgac ttttctggtt
      51  ggtatagctg tgttttcggc ctttgccgga ctgattatca ttgttataac
     101  gatttatcgg tgcacgacta agcctgttag gaacacttct tcttacggca
     151  ctcacgccac tgtctaagcg gtatggtact tctgggttta gactttggta
     201  ccacgttttc gacggtggct atggctacat cctctgagtt agttatactc
     251  aaacaatcta attcatcgta catacctaca tgtttgtttt tgcatgcaga
     301  ccctaacagc gtgtcttatg gttacgatgc ggaatattta gcggcttctg
     351  gggagcctgg ttctttttac aaagatttga aacggtgggt tggttgcact
     401  gcgaagaact accaaaccta cttacacaaa ctatcgcctt cctataaggt
     451  gacggtggaa gagtttggaa ctaagagtgt gccagtccca tatttgtcac
     501  ctctgaataa cgatttggga ctcaatgtcg ctttaccttt actaatcgct
     551  tcgtatgcca aatccatttt gtcggatgcg gaacgagtgt tcaatgtaag
     601  ctgcactgga gttatatgtt cggtacccgc tggttataac acgttgcaac
     651  gagcttttac gcagcagagt atatcgatgt cgggttactc ttgcgtgtac
     701  attattaacg aaccttcagc agccgcatac tccactttac ctaagttgag
     751  ttcggcagat aaatatttag ccgtttacga cttcggcggt gggactttcg
     801  acgtctctgt agttagcgtc agattgccta cgttcgccgt taggagttcg
     851  ggtggtgaca tgaatttagg tggtagagat atcgacaaaa agttatctga
     901  taaaatatac gaaatggcag attttatacc gcaaaaggaa ttgaacgttt
     951  ctagtttaaa ggaagcttta tctcttcaaa ctgatccggt caaatatact
    1001  gtaactcatc acggaatgag tgagacgata tcaattgatc aaacggcgtt
    1051  gagggagata gcttcggtgt tcataaatcg aacgatagat atacttacgc
    1101  aagttaaagt taagtctagt atgcccgaat cgcaaagttt aaagttagtg
    1151  gtagtcggtg gaagctcgta cctaccagga ttgttggata ctttggcaac
    1201  cgtgcctttc gtgtctggga tagtaccagt ggaagacgca agaaccgcgg
    1251  tcgctagagg gtgtgcttta tatagtgagt gcttagatgg taggtccaag
    1301  gccctactaa tagattgtat tacacatcat ttgtcggtta cgacgtttag
    1351  cgcggactcg gtcgttgtcg cagcggccgg tagtccaatt ccttttgaag
    1401  gagaacgaaa actcacgtta cgcaaatgcg ttagcacgtc taactatcaa
    1451  gcaagaatgt ttgaaggaga ttacgaaaag gttttccgaa atgaacgtat
    1501  ctacgcagct tcagtatcgt tgtttacttt aggagttaat tggcgtgtgc
    1551  ctaaagacgt tgaaatgact ctcgtgacca aagtggactc aatgggtaaa
    1601  gtggaatttt accttaaagg tccatctggt gaactagtca acgtgcaagg
    1651  tacttcgcat tacgattata ctggtatgcc tcaccccact agaaatttgg
    1701  tgaagcttag cgattacaat gtaaactccg ccgctttagt tttagctttg
    1751  acattaactc gcgaaaaacg agaaaagttt cttttgcgga cattatttga
    1801  cactttacta gcagatttgc gaaggacagc aagtttaagc gagtactcaa
    1851  agaagtaccc gatcactcga aacgatatcg atgtcgtctc atcacgtatg
    1901  gggatcgttg tttcgaaagt tttacgggga agcgatttgg aaagaatacc
    1951  tctctgaatc aactcgaagt tttgatgaaa gaaacgtgtc gttggaccac
    2001  actttgagtt cgggtgtggt cgtccgtagg cagagtcttt tgaatgcgcc
    2051  tcaagggact ttcgagaacg agttagcgct attgtataat tcggtggtga
    2101  ttaacgattt tgttgagttg actggtatgc cattgaagtc tttgatgaca
    2151  ggtatcgagg accgtaaggt gcctgacgaa ttaatatccg ttgacccgca
    2201  cgaagtcgga tgtagattca cgttaaacga cgtggaatca tatctaataa
    2251  gcaggggcga ggattccgct gatgtaacgg cggtcgagca ttcgtggtgt
    2301  ttgagtaact cttgtggtag actattaagt tcgaccgaga tagatgctta
    2351  caaaaccttg gtgtttacca agaattttga tagtaatgta tctggagtga
    2401  ctactaagtt agagacttat ctatcgtact gtatatcttt gtacaagaaa
    2451  cactgcatga aagacgatga ttattttaat cttatcacac ctatgtttaa
    2501  ttgtttggtg aaagtgctgg cgtcacttgg tttgttttat gagaaacata
    2551  ctgacaatcc gctactgacc ggaatgctta tagagttttg cctagaaaat
    2601  aaggtgtatt actctacttt taaagtaaat ttagacaacg ttagattgtt
    2651  taagtctaaa gtgttgcctg tggtgttaac ggtttgggat atatctgagc
    2701  ctgatgaccc agtggatgaa agggtgctaa ttcctttcga tcctactgat
    2751  tttgtgctcg atttacctaa attgaatata cacgacacaa tggtggtggt
    2801  gggtaatcaa atcagacagt tagagtacgt agtcgagagc gatgctttag
    2851  acgatttatc tcaacacgtt gacatacgtt tagcagcgga caaccccgat
    2901  ctacgcgttg atctgcgttg ggcagggatg tttgtctact acggtgttta
    2951  tcggtgtgct attgatagag tggtagaacg accgacgtta tttagattgc
    3001  cgcagaagtt attgagtcag gatgatggcg aatcgtgctc attgcgcatg
    3051  agtgccgtcg aagctttatt taatctagtg caaaaggtga acagggacat
    3101  aaacgttaga cgtcagttca tgggacgtca cagtaaagtg gctttgcgac
    3151  tgtatcgcaa cttaggtttg aggtttccac cgatctcttc agttaggtta
    3201  ccggttcatc acggttactt atacgtcgat ttttacaaaa gagtacctga
    3251  cgatgctgtt actgccgacg aactcgaaag tttacgtcaa ttacgttcgt
    3301  ccgtggacgt tatgtgtaag gacagggtgt caatcacacc tccaccattc
    3351  aatcgactta gaagaggttc ttctagaaca tttagaggtc gaggcgcacg
    3401  cggtgcgagc tcgcgtcata tgagcagaga cgtggcaact tccggtttta
    3451  atttacctta tcatggcagg ttatacaaca cttcctaata ccgatgacaa
    3501  agaaatgaat ccggtgagtg ccgctgtacc cggtaagtat ccggatgtca
    3551  ttgaaaaatt tgtggccaac aggtccgtag acgcgttaat agaaggcgtc
    3601  ataagtaagt tggataccaa ttcaatatac gaagattcca ctgaaaaatt
    3651  tactggtgaa cacttgaaat acgttatggt tactatggat gctttcttat
    3701  tagaaaacta caagacgaaa acggaagatc tgttggttca cttagctatg
    3751  atccaaaaga ggttgtgcac tacatccacg agcactaaaa ccaagttccg
    3801  cgataaaggt tgtattagtt acgtgcaagg gggttcgcga tataagttaa
    3851  tggataaagt agtttttcct ttcattatat cgaaatttac cgacagggag
    3901  actccgaacg ctctacgtaa gtatgcttgc actttcgagg agttacactt
    3951  gtgtatggct aggttgagac ccgacttata cgaaaataaa aggacgacta
    4001  aagccgggac tccacattta aagggctatt tatcagccga ctttctttcg
    4051  ggttctctcc cagggtactc cgaacatgaa cgaggcatca ttcttcgagc
    4101  gtctgagtct atgttagcta gacgtcaagg ttacgaggag gcaaccgagc
    4151  ttcttaacct acgtgatttg ggtaagtact tgtagttggt ttggggacgg
    4201  taatattatt attataccat cccttgagcg ctgctttaag ggtcgttaat
    4251  tgacgactct tgatatattt actaggtttg aattatggac gacgaaacaa
    4301  agaaattgaa gaacaaaaac aaggaaacga aagaaggcga cgatgttgtt
    4351  gctgctgagt cttctttcgg ttccgtaaac ttacacatcg atccgactct
    4401  gataacgatg aacgatgtgc gtcagttgag tactcaacag aatgctgctt
    4451  tgaacaggga cttatttctt gctctgaaag ggaagtatcc taacttgcct
    4501  gacaaagata aggactttca catagctatg atgttatacc gtttagcggt
    4551  taagagttca tcattgcaaa gtgatgatga caccacgggc ataacgtaca
    4601  ctcgggaggg tgttgaagta gatttgtctg acaaactttg gaccgacatc
    4651  gtgtataatt ctaagggtat tggtaaccga actaacgccc ttcgagtctg
    4701  gggtagaact aacgatgctc tttacttagc cttttgtaga cagaaccgca
    4751  atttgagtta tggcggacgt ccgctagatg cagggattcc ggctgggtat
    4801  cattatttgt gtgcagattt cttgaccgga gctggcttga ctgatttaga
    4851  atgtgctgtg tacatacaag ctaaagaaca attgttgaaa aagcgagggg
    4901  ctgatgaggt tgtagttact aatgtcaggc agcttgggaa atttaacaca
    4951  cgttgatcta ttgcgttccg attcccggtt tctatcggga tggtggagtt
    5001  tcatcgtgaa cgtgggtgat ataattgtcc ggttcgcgtt acacgttcct
    5051  aatgaagata tgctgaatag tttttcagct atatcgaatt gtacgattat
    5101  agcggatggt agtgctttac taaaggacaa tactgtggtt gaccgtttag
    5151  aaagcatgaa tcctttggct tatttgttaa aattagcgaa aacgactact
    5201  actatttgtt ttaccatgtc caataaggtt ctttttggta ctaccaaatc
    5251  cgaaccactt agttgtttag ctatcacgtc ggatcgagtt ttattcaaag
    5301  ttattatggg cgctaacgtt gatgattctc ggtgcggctg cagtatttgg
    5351  ttttacaaca atggtacgtt tcaaaacgga ttgacccgtt gtaataatct
    5401  cgtcactttg tttagcgcga cttagacacg aagtgaccgt tcggatttaa
    5451  ttgctgcgat gagtattcga cgcgtgtggt taaaggttat agctgtaatt
    5501  acagtgttgt ggtacggtaa ggaaccttct attagtgaag gttacaatgc
    5551  tcttatgaat gacgacttta aatttatcga tacgcatttt tctaacgttt
    5601  cttatgctaa gaaatgttac gatttggcta atttcgattt agactttttg
    5651  cgcatcgtta tcattccttt gagtggtggc acggcgaatg aatcgcgttc
    5701  tgatcgcact aacgtttcag agattgtcga atcgcatgta agcgaccgag
    5751  acagaatgca catcttgttg cgtaataagc ggatccagat tccttcgctc
    5801  ttaccctgcg ataactagag tctactcagt agtacgtcta ctagtataac
    5851  gtattaaaca ctttagtgag gagttttgtt tgaatcaaac aatatgcgag
    5901  cttactttag tgttaacgat tacataagcc ttttggctaa ggttggttca
    5951  gttgtggaac gtttgtgcga tcccagcgta actctcacgg aagtgatgga
    6001  cgaaattaat gattttaact cgtttctcgc tttggtgcac tctatgaagt
    6051  cggacatgaa cggcgatcat caggatggtc accatgagat gggtgaacat
    6101  aaatctcggt tgttgtgcaa tatagaggcg aaactgcgag tgcttctcga
    6151  catcataaga cgtcggttta ctcgcgaaaa actgctctgt accagtgcta
    6201  cagatgttgt gggcttcttc gtcgtgaggt acatgagttc tagtcacact
    6251  agtttcgaaa ccgtaatgcg aacggaactg aagttggtgg ttaaagctgt
    6301  gctgtcggaa ttgtcccgca cgcataaact agattttagc gagcgagcct
    6351  ttacggctta cggtatcctt ttgcagaagg gcaccgtggc aaccgtttgc
    6401  ggtcagtttg acattaattt agtttctccg tcttgcgtgt aggttaatac
    6451  gcttctcaga acgtatggtt gtattaacta actttaattc gaacatattt
    6501  attgtttaaa gtctgtgagt tacgatggat gatactagcg gacaaacttt
    6551  cgtttctgtg aacctttctg acgaaagcaa cacggcaagc actaaagttg
    6601  aaaacgtaaa atcggaagcg gatcgcttgg agtttttacg taaaatgaat
    6651  ccctttatta ttgacgctct ggtgcggaaa accaattatc agggtgctcg
    6701  ctttcgcgca agaataatag gagtgtgcgt ggattgtggt agaaaacacg
    6751  acaaggcgct caagactgaa cgtaagtgta aggtcaacaa tacgcaatct
    6801  cagaacgagg tggcgcatat gttgatgcac gatcccgtca agtatttgaa
    6851  caaaagaaag gctagagcct tttctaacgc agagatgttt gcgattgaat
    6901  tggttttgta caccaaggaa aggcaattgg cggtcgattt agccgctgaa
    6951  agggagaaga cgagactggc tcgtagacac ccaatacgtt ctccggaaga
    7001  aactccggaa cattataaat tcggtatgac tgctaaggca atgttaccgg
    7051  acatcaacgc cgtagacgtt ggtgataacg aggaaacttc gtcggagtac
    7101  ccagtgagtc tgagtgtttc tggcggagtt ctccgtgaac accacttcat
    7151  ctgattgaag tggacggaat aagttccttg cggaacttta agtcgggttg
    7201  gtaaaaaccc tttatgatgg tgatgtatca ctagacaata accggatggg
    7251  taaagtcttt aaaatgatcg aggggaaaat taaccgtatc ctctcgttgg
    7301  tctaagctcc cacagagtgg tagtggtctc aagtgaggct taacgtatgc
    7351  gtgaaccaaa gaagttct