Sequence of DPV Grapevine fanleaf virus satellite RNA
Grapevine fanleaf virus satellite RNA (RNA3), complete cds.
ACC No: D00442
Dated: 2003-07-07 | Length: 1114 | CRC: -464239601
!!NA_SEQUENCE 1.0 ID GFLRNA3 standard; RNA; VRL; 1114 BP. XX AC D00442; XX SV D00442.1 XX DT 05-MAR-1991 (Rel. 27, Created) DT 07-JUL-2003 (Rel. 76, Last updated, Version 5) XX DE Grapevine fanleaf virus satellite RNA (RNA3), complete cds. XX KW . XX OS Grapevine fanleaf virus satellite RNA OC Viruses; Satellites; Satellite Nucleic Acids. XX RN [1] RP 1-1114 RX MEDLINE; 89279276. RX PUBMED; 2471799. RA Fuchs M., Pinck M., Serghini M.A., Ravelonandro M., Walter B., Pinck L.; RT "The nucleotide sequence of satellite RNA in grapevine fanleaf virus, RT strain F13"; RL J. Gen. Virol. 70:955-962(1989). XX DR SWISS-PROT; P17768; VP3_GFLV. XX CC The satellite RNA has a polyadenylated 3' end, and probably a CC protein (VPg) linked to the 5' terminus, and produces 39K protein CC in a wheatgerm translation system. Furthermore there is the weaker CC upper band. It may be readthrough product of 39K protein. XX FH Key Location/Qualifiers FH FT source 1. .1114 FT /db_xref="taxon:141860" FT /mol_type="genomic RNA" FT /note="5' end of satellite RNA." FT /note="satellite RNA (RNA3)" FT /organism="Grapevine fanleaf virus satellite RNA" FT /clone="pA4 and pA5" FT misc_feature 3. .10 FT /note="consensus sequence at the 5' end of nepovirus RNAs" FT CDS 15. .1040 FT /codon_start=1 FT /db_xref="SWISS-PROT:P17768" FT /note="39K product, P3" FT /protein_id="BAA00343.1" FT /translation="MDSYVTVDPSFHSPRISLEILVPTKYAKLFTLKQLSRMLALSCKH FT RARQAANPVSKRTSRDRNGSKTMGQGPSAVAPQVSKGHNQQVDGGVCLAPVKSKRAVRR FT EKRRTAAKKATNKAKTETKLVKKGGSSIHAPKAPKRTSYLSSLLSSPSGAKAKMGALSK FT PPQTKNAPDANEGGFTLTAITPAECRAEARRRFHPITGSSRGPYGFCTRSREGCGVCAD FT CVEKKAHLDFNRSFDTIGTSRVIRVDSMMEEVAEDLASPSVLEPSGFWAPAEKQAPSGE FT GHSRRRCDVVTLARVTPVLRMLRKVDPTLVDNRLLWEAAFRTVFPQRKCVYPHGCFCDR FT G" FT variation 720 FT /note="t in clone pA5; c in clone pA4" XX SQ Sequence 1114 BP; 246 A; 295 C; 313 G; 260 T; 0 other; D00442 Length: 1114 July 15, 2003 09:01 Type: N Check: 2791 .. 1 tatgaaaaat ttctatggac tcttacgtta ccgtggatcc atcttttcac 51 tctcccagaa tctcacttga gattctggtc cctaccaagt atgcgaagct 101 gtttaccctt aagcagctct ctcgcatgct tgcattgtcg tgtaagcacc 151 gtgcacggca agccgctaac ccggtaagca aacggacctc ccgagaccga 201 aatgggagta aaacaatggg tcagggtcct tctgctgtgg ccccgcaagt 251 gtcgaaggga cacaatcagc aagtagatgg aggggtttgt ctagccccgg 301 tgaagtcaaa gcgtgcggta cggcgtgaaa agcgccgtac tgccgctaag 351 aaggccacta ataaggccaa gaccgagacc aaactcgtta aaaagggtgg 401 gtctagtatc cacgccccaa aggcaccgaa gcggacgtcg tatttgtcta 451 gtctgctttc gagtccttct ggggcgaaag ccaaaatggg ggctctgagc 501 aagccccccc aaacaaaaaa tgctcccgac gccaacgagg gtggtttcac 551 cctcactgct atcacaccgg ctgagtgccg ggcggaagct aggcgcagat 601 tccaccccat cacaggatcc tctcgtggtc cttatgggtt ctgcacccgc 651 tcccgtgagg gttgtggcgt gtgtgccgat tgtgtggaaa agaaggcaca 701 cctggacttc aaccggagtt ttgacactat tggcacttcg cgtgtcattc 751 gtgtcgactc gatgatggaa gaagtggccg aagacttggc cagccctagt 801 gtcctagaac cctctgggtt ctgggctcct gctgaaaagc aggctccttc 851 tggagagggg cattcccgta gaaggtgcga cgtggtgaca ctcgcacgcg 901 taactccggt tctccggatg ttgcgtaagg tcgatcccac tcttgtggac 951 aaccgacttt tatgggaggc cgcgtttagg acggtctttc ctcagcgcaa 1001 gtgcgtgtat ccccacggtt gcttctgtga ccgtgggtag ggaagattgc 1051 agcgggacat cgtttgttta tagtctggcg taagctggga ttttggttgc 1101 tcattagcca actc