Sequence of DPV Chicory yellow mottle virus satellite RNA
Chicory yellow mottle virus satellite RNA gene for hypothetical protein, complete cds.
ACC No: D00721
Dated: 2007-12-15 | Length: 457 | CRC: 1261790463
ID D00721; SV 1; linear; genomic RNA; STD; VRL; 457 BP. XX AC D00721; XX DT 04-SEP-1992 (Rel. 33, Created) DT 15-DEC-2007 (Rel. 94, Last updated, Version 8) XX DE Chicory yellow mottle virus satellite RNA gene for hypothetical protein, DE complete cds. XX KW . XX OS Chicory yellow mottle virus satellite RNA OC Viruses; Satellites; Satellite Nucleic Acids; OC Single stranded RNA satellites; Circular single stranded RNA satellites. XX RN [1] RP 1-457 RX PUBMED; 1698918. RA Rubino L., Tousignant M.E., Steger G., Kaper J.M.; RT "Nucleotide sequence and structural analysis of two satellite RNAs RT associated with chicory yellow mottle virus"; RL J. Gen. Virol. 71:1897-1903(1990). XX DR RFAM; RF00173. XX CC These data kindly submitted in computer readable form by: CC Luisa Rubino CC Consiglio Nazionale delle Ricerche CC Via Amendola 165/A CC 70126 Bari CC Italy CC The plus strand is shown here. XX FH Key Location/Qualifiers FH FT source 1. .457 FT /organism="Chicory yellow mottle virus satellite RNA" FT /mol_type="genomic RNA" FT /note="satellite RNA S1" FT /db_xref="taxon:192022" FT misc_structure 1. .46 FT /note="hammerhead structure" FT misc_signal complement(39. .54) FT /note="self-cleavage consensus sequence" FT CDS 224. .376 FT /codon_start=1 FT /product="hypothetical protein" FT /note="ORF" FT /db_xref="UniProtKB/TrEMBL:Q66094" FT /protein_id="BAA00623.1" FT /translation="MQTGANHTRMVPDNIPHMVCFPGALRCCMCKSGSASRSWATVLLG FT TRFSI" FT misc_signal complement(255. .306) FT /note="self-cleavage consensus sequence" FT misc_structure 450. .457 FT /note="hammerhead structure" XX SQ Sequence 457 BP; 94 A; 118 C; 130 G; 115 T; 0 other; d00721 Length: 457 15-DEC-2007 Type: N Check: 3534 .. 1 gccagacgtg gacccggcct gatgagtccg aaaggacgaa acagtactgc 51 gctaagaggt gagactactt caatcctctt atgaccttcc ctgctgatgt 101 tacctgggat ttatcctgtg gtaagggtat aggacggtcc taccatacgt 151 gctccacgag tgtattcctc gtgatgagcg gtgggggggt cccgttatgg 201 ggtccagccg gcgacgcatt tctatgcaga ccggtgcaaa ccacacgcgt 251 atggtgccag ataatatacc acacatggtg tgtttccctg gcgcgcttcg 301 ctgttgtatg tgtaagtcgg gctcagcctc ccgcagctgg gcgacggttc 351 tacttggtac ccgattttca atttgagagt tgggctacca acggaacttt 401 cgtccgtgcg gtagggtggg cttgccctga aaacaaccac ctatcaagat 451 tactgtc