Sequence of DPV Tobacco necrosis virus D

Tobacco necrosis virus D genomic RNA, complete genome.

ACC No: D00942

Dated: 2009-10-08 | Length: 3762 | CRC: 196893536

                
ID   D00942; SV 1; linear; genomic RNA; STD; VRL; 3762 BP.
XX
AC   D00942;
XX
DT   12-DEC-1991 (Rel. 30, Created)
DT   08-OCT-2009 (Rel. 102, Last updated, Version 12)
XX
DE   Tobacco necrosis virus D genomic RNA, complete genome.
XX
KW   .
XX
OS   Tobacco necrosis virus D
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus.
XX
RN   [1]
RP   1-3762
RA   Coutts R.H.;
RT   ;
RL   Submitted (08-APR-1991) to the EMBL/GenBank/DDBJ databases.
RL   Contact:Robert H.A. Coutts Imperial College of Science, Technology and
RL   Medicine, Department of Biology; SW7 2BB, Prince Consort Road, London SW7
RL   2BB, U.K.
XX
RN   [2]
RX   PUBMED; 1856691.
RA   Coutts R.H.A., Rigden J.E., Slabas A.R., Lomonossoff G.P., Wise P.J.;
RT   "The complete nucleotide sequence of tobacco necrosis virus strain D";
RL   J. Gen. Virol. 72:1521-1529(1991).
XX
RN   [3]
RA   Offei S.K., Coutts R.H.A.;
RT   "Location of the 5'termini of tobacco necrosis virus strain D subgenomic
RT   mRNAs";
RL   J. Phytopathol. 144:13-17(1996).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3762
FT                   /organism="Tobacco necrosis virus D"
FT                   /strain="D"
FT                   /isolate="Rothamsted, U.K."
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:12056"
FT   misc_difference 1
FT                   /replace="a"
FT                   /citation=[2]
FT   CDS             39. .2216
FT                   /codon_start=1
FT                   /transl_except=(pos:645. .647,aa:OTHER)
FT                   /product="82K protein"
FT                   /note="readthrough stop codon 645-647"
FT                   /db_xref="GOA:P27209"
FT                   /db_xref="InterPro:IPR013707"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27209"
FT                   /protein_id="BAA00785.1"
FT                   /translation="MESLPIVLLSLISKAVVLICSLLTLIIQNSTAVTWGLACVWLAYV
FT                   SFRFLFQVKITVHPAARETFESMVRKFQAESMFSEEATPCIVSVGDKDADLTPDPQRED
FT                   IKIVKSSRRVSYAVRVAHVAKAQVGLLANSRANELVYSRLCREEMVKHGVRPSHIAHMV
FT                   PLAVAACFIPLDSDFLAASIRQGEGMRERRALLGPSWEKXGGLLVTSGFTTPTWRGDPR
FT                   GMLVTKGPPLAKPRKLYRFTGMGTHIRYGVHDHSLGNVRRGLVERLYMVEVKGELQPTP
FT                   KPTPGAFNQMSRFSDRLSIHLPKTTRLTPREFLGFYTGRKLERYQKAVESLEMHPVREK
FT                   DAWLSTFVKAEKLNITAKPDPAPRVIQPRDPRYNVEVGRFLRHSEEMLFKAINKTFGGR
FT                   TIFKGLSSDQAGEEFKTLWDSFKDPVGIGMDASRFDQHISKDALEFEHKMWLSMFPKSE
FT                   RAELARLLSWQINNRGLARCPDGEIRYRVEGCRMSGDMNTSSGNCYIMCATVHNWCDNI
FT                   KHIKHFRLANNGDDCMLVVERSDEKKVRNGLIEYYATLGFTMKVEPTVDVLERLEFCQT
FT                   RPVLVDGKYRMVRNLHQSMSKDLHSLHDLDSSAARNAWVTAVGTGGRCMNDGVPVLKEF
FT                   FKQFPDYNLEVKKGSDMAQKLRDDWKYKFNRTAAFQDLIPTQESRYSFWLAFGLLPDEQ
FT                   IALENGFSPLKMEIVNEQIQEETSLLQFSGA"
FT   CDS             39. .647
FT                   /codon_start=1
FT                   /product="22K protein"
FT                   /db_xref="GOA:P27209"
FT                   /db_xref="InterPro:IPR013707"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27209"
FT                   /protein_id="BAA00786.1"
FT                   /translation="MESLPIVLLSLISKAVVLICSLLTLIIQNSTAVTWGLACVWLAYV
FT                   SFRFLFQVKITVHPAARETFESMVRKFQAESMFSEEATPCIVSVGDKDADLTPDPQRED
FT                   IKIVKSSRRVSYAVRVAHVAKAQVGLLANSRANELVYSRLCREEMVKHGVRPSHIAHMV
FT                   PLAVAACFIPLDSDFLAASIRQGEGMRERRALLGPSWEK"
FT   misc_difference 142
FT                   /replace="t"
FT                   /citation=[2]
FT   CDS             2213. .2401
FT                   /codon_start=1
FT                   /product="7K protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YPI4"
FT                   /protein_id="BAA00787.1"
FT                   /translation="MKTHQFHLKIESRWKIQKMSVVGETNESIVRRGSRRVAIKKLAKL
FT                   PCAKKVMLSRTWVLQFQ"
FT   CDS             2251. .2448
FT                   /codon_start=1
FT                   /product="7K protein"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27211"
FT                   /protein_id="BAA00788.1"
FT                   /translation="MENTENVRSGRNQREYSKERQQEGGYKEVSKAAVRKEGDVKQDMG
FT                   PSVSMTVVGEKVEFTQHFHF"
FT   misc_difference 2294
FT                   /replace=""
FT                   /citation=[2]
FT   misc_difference 2376
FT                   /replace=""
FT                   /citation=[2]
FT   misc_difference 2384
FT                   /replace=""
FT                   /citation=[2]
FT   CDS             2448. .2648
FT                   /codon_start=1
FT                   /product="7K protein"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27212"
FT                   /protein_id="BAA00789.1"
FT                   /translation="MAYIIVHQRDPFPLLGVWIIVIIIVAVIGLLNQSPPERPYQTFKE
FT                   DNSKIQYITIGGSTTTKVSTS"
FT   CDS             2650. .3456
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:P27210"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27210"
FT                   /protein_id="BAA00790.1"
FT                   /translation="MPKRGRVGLAESFQSKTKKQKENEYNAFQREKMERALANNARAAP
FT                   KSSGMTFRPLTVPVAGSVIYSRPRVPQVRTNQMSTFVVNTELVANITLAAAGAFSFTTQ
FT                   PLIPSFGSWLANIADLYSKWRWISCSVVYIPKCPTSTQGSVVMAIVYDAQDTVPTTRTQ
FT                   VSQCYQSITFPPYAGYGGASALNHKGSGGESLVSTLDTNRVDKRWYSTIGNAAFTALTS
FT                   IDKNQFCPATAIIAGDGGPAAATAVGDIFMRYDIEFIEPVNPSINV"
XX
SQ   Sequence 3762 BP; 1032 A; 790 C; 952 G; 988 T; 0 other;

d00942 Length: 3762  08-OCT-2009  Type: N  Check: 6775  ..

       1  gatacctaac cagtgtctca gtgattaagt aatcagctat ggagtcctta
      51  ccaattgtcc tattatccct tatttccaag gcagttgtgc tcatctgtag
     101  tttgttaacc ctaataatcc aaaattccac agcagtgaca tggggcctag
     151  catgcgtatg gttggcatat gtttcgttca ggttcttatt ccaagtcaag
     201  atcacagtcc accccgcagc ccgcgagaca tttgagagca tggtgcgcaa
     251  gttccaagct gagtctatgt ttagcgagga agccacacct tgcatagtca
     301  gcgtaggtga caaggacgca gatctcaccc ccgatccaca aagagaggat
     351  ataaaaattg tgaagtcttc gaggagagtg agttacgcag ttcgtgttgc
     401  ccatgttgcc aaagcccagg tagggttact cgccaacagc agagctaatg
     451  aattggtcta cagccggttg tgcagggaag agatggttaa acatggagtg
     501  agacccagcc atatagcaca catggtgcca cttgctgtgg ctgcatgctt
     551  cattcctttg gatagtgact ttctagccgc ttccatcaga cagggtgaag
     601  gcatgaggga gaggagggcc cttctagggc cctcgtggga gaaataggga
     651  ggcctattag tcacaagcgg attcacaacg ccaacatggc gtggtgatcc
     701  gaggggtatg cttgtgacta aaggacctcc cctcgcgaaa ccccgtaaat
     751  tgtaccgatt tactgggatg ggaacacata ttcggtacgg agtgcatgat
     801  cactcattgg gcaatgttcg gcggggacta gtggaaagat tatatatggt
     851  tgaagttaaa ggagaacttc aaccaactcc aaagcccacc cccggagcgt
     901  tcaaccagat gtcccggttc agtgaccgac tgagtatcca tctgcctaag
     951  accacccgct tgacacctag ggaattcctt gggttttata cgggtcgcaa
    1001  gttggagaga taccagaagg ctgttgagtc gttagagatg catcccgtga
    1051  gggaaaagga tgcctggctt agcacgttcg tgaaggctga aaaattgaat
    1101  atcacagcca aacccgaccc cgctccacgg gtgatacaac ctagggatcc
    1151  taggtataat gtggaggtgg ggcgcttttt gcgacacagt gaggaaatgt
    1201  tgttcaaggc cattaataaa acatttggcg gaaggactat tttcaagggc
    1251  ctcagctctg atcaagctgg ggaggagttt aaaacgctct gggattcatt
    1301  caaggatcca gtcggcattg gtatggatgc ttctagattt gaccaacaca
    1351  tatctaaaga tgctcttgag tttgagcaca agatgtggct tagcatgttc
    1401  cctaaaagtg agcgtgcaga gttagctcga ttgttgagtt ggcagattaa
    1451  taatagaggc ctagcccggt gtccggatgg ggagattaga tacagagtgg
    1501  aagggtgtag aatgtctggg gacatgaata cctctagcgg aaattgttac
    1551  atcatgtgtg caacagtgca taattggtgt gataatatca aacatattaa
    1601  gcatttcaga cttgccaata atggtgacga ctgcatgctg gttgttgaac
    1651  gcagtgatga gaagaaagtc cgtaatgggc taattgagta ctatgcaaca
    1701  cttgggttta cgatgaaggt tgagcccaca gtggatgtat tggaaaggtt
    1751  agagttttgc cagacaagac ctgttttagt ggatggcaag taccgaatgg
    1801  tgcgaaacct tcatcagagc atgtctaaag atctacactc attgcatgac
    1851  cttgatagta gtgccgcgcg taacgcatgg gttacagccg ttggaactgg
    1901  gggaaggtgt atgaatgatg gggtgcctgt tctcaaagaa tttttcaaac
    1951  agtttccaga ttataatttg gaagtcaaga aaggttctga tatggcacag
    2001  aagttgagag atgattggaa gtataagttc aataggactg ctgcttttca
    2051  ggatctcatc cccacccagg aatcacgtta ctccttttgg cttgcgttcg
    2101  ggttgttacc tgatgaacaa attgccctgg aaaatggctt ctcccctttg
    2151  aagatggaga tagttaatga gcagatccag gaggagacat ctctcctcca
    2201  gttttctggg gcatgaaaac tcaccaattt caccttaaga tcgagtctag
    2251  atggaaaata cagaaaatgt ccgtagtggg agaaaccaac gagagtatag
    2301  taaggagagg cagcaggagg gtggctataa agaagttagc aaagctgccg
    2351  tgcgcaaaga aggtgatgtt aagcaggaca tgggtccttc agtttcaatg
    2401  acggtggtgg gtgagaaagt tgaattcacc caacattttc atttttaatg
    2451  gcttacatta ttgttcatca acgtgatcca tttccccttc taggggtttg
    2501  gatcattgtt atcatcattg tcgcagttat tggtttattg aaccaaagcc
    2551  ctcctgaaag accttaccaa actttcaaag aagataattc taagattcaa
    2601  tacattacaa tcggaggatc gaccactaca aaagtgtcta ctagttaata
    2651  tgcctaagcg aggaagagtt ggattggctg aatcttttca gtccaagaca
    2701  aagaagcaga aggagaatga atacaacgcg tttcagagag agaaaatgga
    2751  acgagctctg gcgaataatg cccgcgcagc accaaagagt tctgggatga
    2801  ctttccgccc cttaactgtt ccggttgctg ggtctgttat ctatagcagg
    2851  ccacgcgtgc cacaggtccg caccaaccag atgtccactt ttgtggtcaa
    2901  tactgagttg gttgctaata ttacattggc agctgcggga gcttttagtt
    2951  tcacaacaca accgttgatt cctagttttg gatcttggtt agcaaatatc
    3001  gcggatctct attctaaatg gagatggata tcatgttccg ttgtgtatat
    3051  accaaaatgt cctacttcta ctcaaggaag tgtggtcatg gcgatagtat
    3101  acgacgcaca agatactgtt ccaactacac gtacacaagt ttcacaatgc
    3151  tatcaatcca tcacattccc tccatatgct ggatacggag gagcctctgc
    3201  actgaaccat aagggttctg gtggtgaatc gttggtgtcc acgttggata
    3251  ccaatagagt ggataaacga tggtacagca ccatcggtaa cgctgctttt
    3301  actgctctca catcaattga caagaatcag ttctgtccag ccacagctat
    3351  tattgctggg gatggaggac ctgctgctgc cactgctgtc ggagatattt
    3401  tcatgcgata cgacatcgag ttcattgaac cggtcaatcc ctccatcaat
    3451  gtttaattgc tttcatagat ccgtcttccg ggagacgtta agaagacacc
    3501  cgataaaaat agtaagtaga gttgtggcgt gacaacccac aactgcatct
    3551  ctttgcttat ctaattacaa tatatgttga cgtacaagcc ggatcctggg
    3601  aaacaggttt aacgggctca ctgtggtggt gggccgtcga tacacttgta
    3651  tgtgccccaa tattggttgt cgataagcgt cctgacatgg ctccatgcaa
    3701  cagcatgggg gggtccagag tcagtcccct ctttatttac ctagagatct
    3751  ctctaggaac cc