Sequence of DPV Nicotiana tabacum Tto1 virus

Tobacco DNA, retrotransposon Tto1 sequence encoding an ORF (1338AA), complete cds.

ACC No: D83003

Dated: 2002-03-01 | Length: 5300 | CRC: -983085965

                !!NA_SEQUENCE 1.0
ID   NTAA       standard; genomic DNA; PLN; 5300 BP.
XX
AC   D83003;
XX
SV   D83003.1
XX
DT   29-JAN-1996 (Rel. 46, Created)
DT   01-MAR-2002 (Rel. 70, Last updated, Version 5)
XX
DE   Tobacco DNA, retrotransposon Tto1 sequence encoding an ORF (1338AA),
DE   complete cds.
XX
KW   retrotransposon; Tto1.
XX
OS   Nicotiana tabacum (common tobacco)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; core eudicots; asterids;
OC   lamiids; Solanales; Solanaceae; Nicotiana.
XX
RN   [1]
RP   1-5300
RA   Hirochika H.;
RT   ;
RL   Submitted (10-JAN-1996) to the EMBL/GenBank/DDBJ databases.
RL   Hirohiko Hirochika, National Institute of Agrobiological Resources,
RL   Molecular Biology; 2-1-2 Kannondai, Tsukuba, Ibaraki 305, Japan
RL   (E-mail:hirohiko@abr.affrc.go.jp, Tel:0298-38-7006, Fax:0298-38-7408)
XX
RN   [2]
RP   1-5300
RA   Hirochika H., Otsuki H., Yoshikawa M., Otsuki Y., Takeda S.;
RT   "Autonomous Transposition of the Tobacco Retrotransposon Tto1 in Rice";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1105/tpc.8.4.725.
RX   MEDLINE; 96206818.
RX   PUBMED; 8624443.
RA   Hirochika H., Otsuki H., Yoshikawa M., Otsuki Y., Sugimoto K., Takeda S.;
RT   "Autonomous transposition of the tobacco retrotransposon Tto1 in rice.";
RL   Plant Cell 8(4):725-734(1996).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5300
FT                   /db_xref="taxon:4097"
FT                   /mol_type="genomic DNA"
FT                   /organism="Nicotiana tabacum"
FT                   /clone="Tto1-1"
FT                   /strain="BY-2"
FT   repeat_region   1. .5300
FT                   /transposon="retrotransposon Tto1"
FT   LTR             1. .574
FT   TATA_signal     168. .173
FT   CDS             716. .4732
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9ZRJ0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="UniProt/TrEMBL:Q9ZRJ0"
FT                   /product="ORF(AA 1-1338)"
FT                   /protein_id="BAA11674.1"
FT                   /translation="MEARTSKMVNLNGTNYHLWRNKMKDLLFVTKMHLPVFSSQKPEDK
FT                   SDEDWEFEHNQVCGYIRQFVEDNVYNHISGVTHARSLWDKLEELYASKTGNNKLFYLTK
FT                   LMQVKYVEGTTVADHLNEIQGIVDQLSGMGIKFDDEVLALMVLATLPESWETLKVSITN
FT                   SAPNGVVNMETVKSGILNEEMRRRSQGTSSSQSEVLAVTTRGRSQNKSQSNRDKSRGKS
FT                   NKFANVECHYCKKKGHIKRFCRQFQNDQKKNKGKKVKPEESSDDETNSFGEFNVVYDDD
FT                   IINLTTQEMTWVIDSGATIHATPRRELFSSYTLGDFGRVKMGNANFSTVVGKGDVCLET
FT                   MNGMKLLLRDVRHVPDMRLNLISVDKLDEEGYCNTFHNGQWKLTKGSLMVARGTKQSKL
FT                   YVTQASISQQVINVAENDSNIKLWHRRLGHMSEKSMARLVKKNALPGLNQIQLKKCADC
FT                   LAGKQNRVSFKRFPPSRRQNVLDLVHSDVCGPFKKSLGGARYFVTFIDDHSRKTWVYTL
FT                   KTKDQVFQVFKQFLTLVERETGKKLKCIRTDNGGEYQGQFDAYCKEHGIRHQFTPPKTP
FT                   QLNGLAERMNRTLIERTRCLLSHSKLPKAFWGEALVTAAYVLNHSPCVPLQYKAPEKIW
FT                   LGRDISYDQLRVFGCKAYVHVPKDERSKLDVKTRECVFIGYGQDMLGYKFYDPVEKKLV
FT                   RSRDVVFVEDQTIEDIDKVEKSTDDSAEFELPPTVVPRQVGDDVQDNQPEAPGLPNEDE
FT                   LADTEGNEDNGDDDADEEDQPQPPILNNPPYHTRSGRVVQQSTRYSPHEYVLLTDGGEP
FT                   DSFEEAIDDEHKEKWIEAMQDEIKSLHENKTFELVKLPKGKRALKNKWVFKMKHDEHNS
FT                   LPRFKARLVVKGFNQRKGIDFDEIFSPVVKMTSIRTVLGLAASLNLEVEQMDVKTAFLH
FT                   GDLEEEIYMEQPDGFQQKGKEDYVCRLRKSLYGLKQAPRQWYKKFESVMGQHGYKKTTS
FT                   DHCVFAQKFSDDDFIILLLYVDDMLIVGRNVSRINSLKEQLSKFFAMKDLGPAKQILGM
FT                   RIMRDREAKKLWLSQEKYIEKVLQRFNMEKTKAVSCPLANHFRLSTKQSPSTDDERRKM
FT                   ERIPYASAVGSLMYAMVCTRPDIAHAVGVVSRFLSNPGKEHWDAVKWILRYLRGTSKLC
FT                   LCFGEDNPVLVGYTDADMAGDVDSRKSTSGYLINFSGGAVSWQSKLQKCVALSTTEAEF
FT                   IAATEACKELIWMKKFLTELGFSQDGYQLFCDSQSAIHLAKNASFHSRSKHIDVRYNWI
FT                   RDVLEKKMLRLEKIHTDENGSDMLTKTLPKGKFEFCREAAGIVDPPYSWKGENC"
FT   LTR             4727. .5300
XX
SQ   Sequence 5300 BP; 1623 A; 944 C; 1315 G; 1418 T; 0 other;

   D83003  Length: 5300  May 9, 2005 17:26  Type: N  Check: 8755  ..

       1  tgttagtttt tccaacaatt atggtgatgt atgggagagg taagcaatga
      51  tgcaactctc cttagtgaga taagcaatga tgcaatgagt ggtaggtgag
     101  atgagaatat tgcaaattga tccttcttgg taggtgagat ttgcactttt
     151  ggtccctatc tcaaaactat aaataccccc ttccatttca ttgtataaca
     201  caccaaaaaa tatatcaaaa ctcaagaaga aagagtttga gagggagaga
     251  gatatagttc ctttaggaat gtttcctaac aggggagtga caaaatagtg
     301  agtagaaata ctagtcgggt atttttcggg aaacactttt gtgtgcgcca
     351  ctattttggg tagagctcag gaattgttgt acctccaaat tattgaggaa
     401  gtctctcttt gtatgcctgc taaatgtttt agtggaagtt ggtgtcggat
     451  ttgtggacgt agcctaaacg ttttaggtga accacgttaa atattgtgtc
     501  atttattttt ggtttcgttg atcatttatt ttattccgct gtgcagtagt
     551  gtttagtgcc accggatcct aacaagtggt atcagagctt tggttagagt
     601  actattcata cgtacgagta ctattcatcc atacgggcac tattcatatc
     651  cacggttact attcaccgtc ggattttttt tttagattgc aaaagtctgt
     701  caaattctga tctaaatgga ggcgaggaca agcaagatgg tcaacctgaa
     751  tggcacaaat tatcacttat ggagaaacaa gatgaaggat ctcctgttcg
     801  tgacaaagat gcacctgccg gtgttcagtt ctcagaaacc tgaagataag
     851  tcagacgagg actgggaatt tgagcacaac caagtgtgcg gctacatacg
     901  gcaatttgtt gaagacaatg tgtacaacca catttctggt gtgacacatg
     951  caaggtcgtt atgggacaag ctcgaagagt tgtatgcctc taaaacaggt
    1001  aacaacaaat tattttactt gacaaaatta atgcaagtaa aatatgtaga
    1051  agggacaact gtggcagatc accttaatga aatacaaggg attgtcgacc
    1101  agttgtcggg aatgggcata aagttcgatg acgaggtact tgctcttatg
    1151  gtgctggcaa cactcccaga gtcatgggaa accttgaagg tttcaatcac
    1201  caattctgca cccaacggtg tggtaaacat ggagacagtc aagagtggca
    1251  ttctgaatga agaaatgaga cgccgatcac aaggaacatc ttcttcacag
    1301  tcagaggtgt tggctgttac gaccaggggg agaagtcaaa ataagagcca
    1351  gagtaacaga gataagagca gaggtaaatc caacaaattt gcaaatgttg
    1401  agtgccatta ctgcaaaaag aaggggcata tcaaaagatt ttgccgacag
    1451  ttccagaatg accagaagaa gaacaaaggc aaaaaggtga agcccgaaga
    1501  aagcagtgat gatgaaacga actcctttgg tgagttcaac gttgtctacg
    1551  atgacgacat tatcaatctg acaacccaag agatgacctg ggtgattgat
    1601  agtggggcta ccattcatgc gacgccacgg agagaactct tctcatctta
    1651  cacacttgga gactttggtc gtgtaaagat gggaaatgcc aatttctcaa
    1701  cagttgtagg caaaggtgat gtttgcctag agaccatgaa tgggatgaag
    1751  ctacttttaa gagatgtcag gcatgttcca gatatgcgcc tgaatctgat
    1801  ctccgtagac aagctcgatg aggaaggtta ctgcaatacc ttccataatg
    1851  gccaatggaa gctcacgaag ggctcattga tggtggcgcg gggcacgaag
    1901  cagtcaaagt tgtacgtgac ccaggcgagc atctcccaac aagttataaa
    1951  tgttgcggag aatgatagca atatcaagtt gtggcataga cgtcttggcc
    2001  acatgagtga gaagtcaatg gcgcgtttgg taaagaagaa cgccttacca
    2051  ggtctaaacc agatccagtt gaagaagtgt gctgactgtt tagctgggaa
    2101  acaaaacaga gtttcgttca aaagattccc tccttccaga aggcaaaatg
    2151  tgttggatct ggtacactca gatgtatgtg ggcctttcaa gaagtccctc
    2201  ggtggtgccc gatatttcgt gacctttatt gatgatcatt cacgaaagac
    2251  atgggtatac acgctgaaga ccaaggatca agtgtttcaa gttttcaaac
    2301  agtttctgac cttggtggaa agagagactg gtaagaagtt gaagtgcatc
    2351  cggacagaca atggcggtga ataccagggt caatttgatg cttactgtaa
    2401  agagcatggt attcgacatc agttcacacc tcctaaaact ccccagttga
    2451  atggcttggc tgagaggatg aacagaactt tgatcgagag aaccagatgt
    2501  ttactctctc attcaaagtt accaaaggct ttctggggtg aagctctagt
    2551  tacagcagcc tatgtgctga accattcacc ctgtgtccct cttcagtaca
    2601  aggctccaga aaagatttgg ttaggaagag atatctctta tgatcaatta
    2651  cgggtatttg gctgcaaagc ctatgtccat gttccgaaag atgaaaggag
    2701  caaacttgat gtcaagacaa gggagtgtgt attcatcggc tatggtcaag
    2751  acatgcttgg ctataagttc tatgatccgg tggaaaagaa gctcgtcagg
    2801  agtcgagatg tcgtgttcgt tgaggaccaa acaattgaag acattgacaa
    2851  agtagagaag tccactgatg attctgctga gtttgagttg cctccaacag
    2901  tggtgccgag acaagttgga gatgatgttc aggataatca acctgaagcc
    2951  cctggtcttc ctaatgaaga tgaactagca gatactgaag gtaacgagga
    3001  caatggtgat gatgatgcag acgaggagga tcaacctcaa ccaccaatcc
    3051  tcaataaccc tccttatcac acaagatctg gaagagttgt gcaacagtct
    3101  accagatatt ctccacatga gtatgtgtta ctcactgacg ggggagaacc
    3151  cgacagcttt gaagaagcta ttgatgatga acataaggag aagtggatag
    3201  aagccatgca agacgagata aaatccttgc atgagaacaa gacgtttgag
    3251  ctggtgaagt tgccgaaagg caagagagct ttgaagaata agtgggtgtt
    3301  caagatgaag catgatgaac acaattccct tccgagattc aaagcaagat
    3351  tggtcgtcaa aggtttcaat caaaggaaag gcattgactt tgatgaaata
    3401  ttctcaccag ttgtgaaaat gacctcaata cgcacggtgc tgggattagc
    3451  agcaagcctc aacctggagg ttgaacagat ggatgtaaaa actgccttcc
    3501  tacatggtga tttggaagag gagatataca tggagcaacc agacggtttc
    3551  cagcaaaagg ggaaagagga ctacgtttgt agattgagga aaagcctcta
    3601  tggcttaaaa caggcaccaa ggcagtggta caagaagttc gagtcggtga
    3651  tggggcaaca cggctacaag aagacaactt cagaccattg tgtgttcgct
    3701  cagaagtttt ctgacgatga tttcatcatc ctattgctct atgtagatga
    3751  tatgttgatt gttggccgga atgtttccag aattaatagc ttaaaagaac
    3801  agctaagcaa gttcttcgcc atgaaagact tggggccagc aaaacagatc
    3851  cttgggatga ggattatgcg agaccgagaa gccaagaagt tatggttgtc
    3901  tcaggagaag tacatcgaga aggtacttca acggttcaac atggagaaaa
    3951  ctaaagcagt tagctgtcct cttgctaacc actttagatt gagcaccaag
    4001  caaagcccgt caacagatga tgagagaaga aagatggagc ggattccata
    4051  tgcttcagca gtaggaagtt tgatgtatgc catggtttgt acacggccag
    4101  atatcgctca cgctgtagga gtggtaagta gatttctttc taatccaggt
    4151  aaggaacatt gggatgctgt taagtggatt ctcaggtatc ttcgaggaac
    4201  ctccaaacta tgcttatgtt ttggagaaga caaccctgtg ttggttggct
    4251  atactgatgc agatatggcc ggagatgttg attctagaaa atcaacttca
    4301  ggatacttga ttaacttttc agggggagct gtgtcatggc aatcaaagtt
    4351  gcaaaaatgt gttgcattat caactactga agctgaattc atcgcagcaa
    4401  cggaggcttg caaagaattg atatggatga agaagttctt aactgaactt
    4451  ggattttcgc aagacggtta tcagttattt tgtgatagtc aaagtgctat
    4501  ccaccttgcg aagaatgcct cattccattc cagatccaaa catattgatg
    4551  tgagatataa ttggatcagg gatgtgttgg agaagaagat gttgcggctt
    4601  gaaaagatcc atacagacga aaatggatcg gacatgttga ccaagacttt
    4651  accgaaaggg aagtttgagt tctgtagaga agctgcaggg atagtggatc
    4701  caccatatag ttggaagggg gagaattgtt agtttttcca acaattatgg
    4751  tgatgtatgg gagaggtaag caatgatgca actctcctta gtgagataag
    4801  caatgatgca atgagtggta ggtgagatga gaatattgca aattgatcct
    4851  tcttggtagg tgagatttgc acttttggtc cctatctcaa aactataaat
    4901  acccccttcc atttcattgt ataacacacc aaaaaatata tcaaaactca
    4951  agaagaaaga gtttgagagg gagagagata tagttccttt aggaatgttt
    5001  cctaacaggg gagtgacaaa atagtgagta gaaatactag tcgggtattt
    5051  ttcgggaaac acttttgtgt gcgccactat tttgggtaga gctcaggaat
    5101  tgttgtacct ccaaattatt gaggaagtct ctctttgtat gcctgctaaa
    5151  tgttttagtg gaagttggtg tcggatttgt ggacgtagcc taaacgtttt
    5201  aggtgaacca cgttaaatat tgtgtcattt atttttggtt tcgttgatca
    5251  tttattttat tccgctgtgc agtagtgttt agtgccaccg gatcctaaca