Sequence of DPV Raspberry leaf mottle virus

Raspberry mottle virus from USA major coat protein gene, complete cds.

ACC No: DQ016612

Dated: 2007-06-13 | Length: 597 | CRC: -1779650704

                
ID   DQ016612; SV 1; linear; genomic RNA; STD; VRL; 597 BP.
XX
AC   DQ016612;
XX
DT   12-OCT-2006 (Rel. 89, Created)
DT   13-JUN-2007 (Rel. 92, Last updated, Version 3)
XX
DE   Raspberry mottle virus from USA major coat protein gene, complete cds.
XX
KW   .
XX
OS   Raspberry mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RX   PUBMED; 17448559.
RA   Tzanetakis I.E., Halgren A., Mosier N., Martin R.R.;
RT   "Identification and characterization of Raspberry mottle virus, a novel
RT   member of the Closteroviridae";
RL   Virus Res. 127(1):26-33(2007).
XX
RN   [2]
RP   1-597
RA   Tzanetakis I.E., Halgren A.B., Mosier N., Martin R.R.;
RT   ;
RL   Submitted (25-APR-2005) to the EMBL/GenBank/DDBJ databases.
RL   Botany & Plant Pathology, Oregon State University and USDA-ARS, 3420
RL   Orchard Ave., Corvallis, OR 97330, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Raspberry mottle virus"
FT                   /isolate="HCRL-WA"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /db_xref="taxon:326941"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /note="CP"
FT                   /db_xref="GOA:Q00P87"
FT                   /db_xref="UniProtKB/TrEMBL:Q00P87"
FT                   /protein_id="AAY82289.1"
FT                   /translation="MAEFTIADLKEINVADNTTLSEEVEAKITKPLLAKIETANPGFDD
FT                   KGAKLLVGMILYRLALRTTSPNATFNAHDVTTYKVDGKSVKFDDEMVFGYIANHEATPP
FT                   GIKNPLRAWGRTLDQKYLKFIRPLKTTLDFNQRCNKIGLPVGYEYPCADFLTGAGLDNQ
FT                   EAAILNLGRAEALKKEAGDTGHSITSIKQLGRFST"
XX
SQ   Sequence 597 BP; 170 A; 143 C; 142 G; 142 T; 0 other;

dq016612 Length: 597  13-JUN-2007  Type: N  Check: 6527  ..

       1  atggcggaat tcacgatcgc agacttgaaa gaaattaatg tagcagataa
      51  caccaccctt tcggaggagg tggaggcaaa gattaccaaa ccgctcctcg
     101  ctaaaatcga gactgccaat cccggttttg atgacaaagg cgccaaattg
     151  ttagtaggga tgatacttta caggttggct ttgcgtacta cttcacccaa
     201  cgccactttt aacgcacacg acgtcaccac ctacaaagta gatggtaaga
     251  gtgtgaaatt cgatgatgaa atggtattcg gttacattgc taatcacgag
     301  gctaccccac ccggtatcaa gaaccctctc agggcttggg gccgcacgct
     351  agatcaaaaa tatctaaaat tcattcggcc attgaagacc actttggact
     401  tcaatcagcg ttgcaataag atagggcttc ctgtaggtta tgagtacccg
     451  tgtgccgatt ttcttaccgg ggctggtttg gacaaccaag aggctgccat
     501  actgaaccta ggtagagcag aggctctcaa gaaggaggct ggcgacaccg
     551  gtcattcgat cacctcgata aagcagttag gtcgcttttc cacctaa