Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone ctv3 capsid protein gene, partial cds; P18 (P18) gene, complete cds; and P13 (P13) gene, partial cds.

ACC No: DQ074980

Dated: 2005-07-26 | Length: 841 | CRC: 1873625420

                !!NA_SEQUENCE 1.0
ID   DQ074980   standard; genomic RNA; VRL; 841 BP.
XX
AC   DQ074980;
XX
SV   DQ074980.1
XX
DT   26-JUL-2005 (Rel. 84, Created)
DT   26-JUL-2005 (Rel. 84, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone ctv3 capsid protein gene, partial cds; P18
DE   (P18) gene, complete cds; and P13 (P13) gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-841
RA   Hilf M.E.;
RT   "Resistance breaking citrus tristeza virus isolate";
RL   Unpublished.
XX
RN   [2]
RP   1-841
RA   Hilf M.E.;
RT   ;
RL   Submitted (25-MAY-2005) to the EMBL/GenBank/DDBJ databases.
RL   USDA-ARS-USHRL, 2001 S. Rock Road, Fort Pierce, FL 34945, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .841
FT                   /country="USA"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="Poncirus resistance breaking strain"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="NS25"
FT                   /clone="ctv3"
FT   CDS             <1. .84
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /protein_id="AAZ15657.1"
FT                   /translation="KEQLLKKRGADEVVVTNVRQLGKFNTR"
FT   gene            50. .523
FT                   /gene="P18"
FT   CDS             50. .523
FT                   /codon_start=1
FT                   /gene="P18"
FT                   /product="P18"
FT                   /protein_id="AAZ15658.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFVSGWWSFIVNVGDIIVRFALHVPSE
FT                   DVLNSFSAISNCTIIADGSALLKDNTVVDRLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLICLAITSDRVLFKVIMGTNVDDSRCGCSIWFYNNGMFQNGLTPL"
FT   gene            588. .>841
FT                   /gene="P13"
FT   CDS             588. .>841
FT                   /codon_start=1
FT                   /gene="P13"
FT                   /product="P13"
FT                   /protein_id="AAZ15659.1"
FT                   /translation="MSIRRVWLKVMAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYELANFDLDFLRIVVIPLSGGAVNESRADRA"
XX
SQ   Sequence 841 BP; 218 A; 141 C; 200 G; 282 T; 0 other;

 DQ074980  Length: 841  August 2, 2005 08:54  Type: N  Check: 1836  ..

       1  aaagaacaat tgttgaagaa gcgaggggct gatgaagtcg tagttactaa
      51  tgtcaggcag cttgggaaat ttaacacacg ttgatctatt gcgttctgat
     101  tcccggtttg tatcgggatg gtggagtttc atcgtgaacg tgggtgatat
     151  aatcgttcgg tttgcgttac acgttcctag tgaagatgtg ctgaacagct
     201  tttcagctat atcgaattgt acgatcatag cggacggtag tgctttacta
     251  aaagacaaca ccgtggttga ccgtttagag agcatgaacc ctttggctta
     301  tttgttaaaa ttagcgaaaa cgactactac tatttgtttt actatgtcta
     351  ataaggttct ttttggtact actaaatccg aaccgcttat ttgtttagct
     401  attacatcgg accgagtttt attcaaagtt attatgggta ctaacgttga
     451  tgattctcga tgtggctgca gtatttggtt ttacaacaat gggatgtttc
     501  aaaatgggtt gaccccgttg taataatctc gtcgctttgt ttagcgcgac
     551  ttagacacga agtgaccgtt cgggtttaat tgctgcaatg agtattcgac
     601  gtgtgtggtt aaaggtaatg gctgtaatta cggtattgtg gtatggtaaa
     651  gaaccttcca ttagcgaagg ttacaacgct cttatgaatg atgactttaa
     701  gtttatcgat acgcattttt caaacgtctc ttatgctaag aaatgttacg
     751  aattggctaa tttcgattta gactttctac gcatcgttgt cattccccta
     801  agtggtggtg cggtgaatga atcgcgtgca gatcgcgcta a