Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone ctv9 P33 (P33) gene, partial cds; P6 (P6) gene, complete cds; and P65 (P65) gene, partial cds.

ACC No: DQ074982

Dated: 2005-07-26 | Length: 1030 | CRC: 1316379450

                !!NA_SEQUENCE 1.0
ID   DQ074982   standard; genomic RNA; VRL; 1030 BP.
XX
AC   DQ074982;
XX
SV   DQ074982.1
XX
DT   26-JUL-2005 (Rel. 84, Created)
DT   26-JUL-2005 (Rel. 84, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone ctv9 P33 (P33) gene, partial cds; P6 (P6) gene,
DE   complete cds; and P65 (P65) gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-1030
RA   Hilf M.E.;
RT   "Poncirus resistance breaking CTV";
RL   Unpublished.
XX
RN   [2]
RP   1-1030
RA   Hilf M.E.;
RT   ;
RL   Submitted (25-MAY-2005) to the EMBL/GenBank/DDBJ databases.
RL   USDA-ARS-USHRL, 2001 S. Rock Road, Fort Pierce, FL 34945, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1030
FT                   /country="New Zealand"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="Poncirus resistance breaking strain"
FT                   /organism="Citrus tristeza virus"
FT                   /serotype="MCA13+"
FT                   /isolate="NS25"
FT                   /clone="ctv9"
FT   gene            <1. .27
FT                   /gene="P33"
FT   CDS             <1. .27
FT                   /codon_start=1
FT                   /gene="P33"
FT                   /product="P33"
FT                   /protein_id="AAZ15660.1"
FT                   /translation="GLLAVIFI"
FT   gene            97. .252
FT                   /gene="P6"
FT   CDS             97. .252
FT                   /codon_start=1
FT                   /gene="P6"
FT                   /product="P6"
FT                   /protein_id="AAZ15661.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNASPY
FT                   GTHATV"
FT   gene            258. .>1030
FT                   /gene="P65"
FT   CDS             258. .>1030
FT                   /codon_start=1
FT                   /gene="P65"
FT                   /product="P65"
FT                   /protein_id="AAZ15662.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTEKNYQSYLHKLSPSYKVIVKEFGIKSMP
FT                   VPCLSPLNNDLGLSVALPSLIASYTKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSVSLSGYTCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELADFLPQKEL"
XX
SQ   Sequence 1030 BP; 244 A; 196 C; 247 G; 343 T; 0 other;

 DQ074982  Length: 1030  August 2, 2005 08:54  Type: N  Check: 4806  ..

       1  ggtttgttag ctgttatatt catatgactt ggtgtagtaa cttatagggc
      51  atggttagct aaaactcacc gtttgactct gtttaaacgg ggttcaatgg
     101  actgtgtgat tcaaggattt ttgacttttc tagttggtat agctgtgttt
     151  tcggcttttg ccggactaat tatcattgtt ataacgattt atcggtgcac
     201  gactaagccc gttagaaacg cctctcctta cggcactcac gccactgttt
     251  aagcggtatg gtgcttctgg gtttagactt tggtaccacg ttttcgacgg
     301  tggctatggc tacatcttct gagttagtaa tacttaaaca atccaattcg
     351  tcgtacatac ctacgtgttt gtttctgcat gcagatccta acagcgtgtc
     401  ttatggttac gatgcggagt acttagcggc ttcgggggaa cctggctcgt
     451  tttacaaaga tttgaaacgg tgggtcggtt gtactgagaa gaactaccaa
     501  agttatttgc acaagttatc accttcctat aaggtgatag taaaggagtt
     551  cggaattaag agtatgccgg ttccgtgctt gtcacctctt aataatgatc
     601  ttgggctcag tgtcgctttg ccttctttga tcgcttcata taccaaatcg
     651  attttatcgg atgcggagag agtgttcaac gtgagttgca ctggagttat
     701  atgttcggta cctgctggtt ataacacgtt acaacgagct tttacacaac
     751  aaagcgtgtc cttgtcgggt tatacttgcg tgtacattat taatgaacct
     801  tccgctgccg cttactccac tttacctaag ttgagttcgg cggataagta
     851  cttggccgtt tacgacttcg gcggtgggac ctttgatgtt tctatagtta
     901  gtgttaggtt acccacgttt gccgttagaa gttcgggtgg tgatatgaac
     951  ttaggcggta gagacatcga cagaaagtta tctgataaaa tatatgagtt
    1001  ggctgatttt ttaccgcaaa aagaactgaa