Sequence of DPV Olive latent virus 1

Olive latent virus 1 isolate GM6, complete genome.

ACC No: DQ083996

Dated: 2005-10-23 | Length: 3702 | CRC: -6489421

                !!NA_SEQUENCE 1.0
ID   DQ083996   standard; genomic RNA; VRL; 3702 BP.
XX
AC   DQ083996; AY611067;
XX
SV   DQ083996.1
XX
DT   23-OCT-2005 (Rel. 85, Created)
DT   23-OCT-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Olive latent virus 1 isolate GM6, complete genome.
XX
KW   .
XX
OS   Olive latent virus 1
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus.
XX
RN   [1]
RP   1-3702
RX   DOI; 10.1016/j.virusres.2004.09.007.
RX   PUBMED; 15681070.
RA   Felix M.R., Cardoso J.M., Oliveira S., Clara M.I.;
RT   "Viral properties, primary structure and phylogenetic analysis of the coat
RT   protein of an Olive latent virus 1 isolate from Olea europaea L";
RL   Virus Res. 108(1-2):195-198(2005).
XX
RN   [2]
RP   1-3702
RX   PUBMED; 16132177.
RA   Felix M.R., Cardoso J.M., Varanda C.M., Oliveira S., Clara M.I.;
RT   "Complete nucleotide sequence of an Olive latent virus 1 isolate from olive
RT   trees";
RL   Arch. Virol. 150(11):2403-2406(2005).
XX
RN   [3]
RP   1-3702
RA   Felix M.R., Cardoso J.M.S., Oliveira S., Clara M.I.E.;
RT   ;
RL   Submitted (28-APR-2004) to the EMBL/GenBank/DDBJ databases.
RL   Departamento de Sanidade Animal e Vegetal, Universidade de Evora, Apartado
RL   94, Evora 7002-554, Portugal
XX
RN   [4]
RC   Nucleotide sequence updated by submitter
RP   1-3702
RA   Felix M.R., Cardoso J.M.S., Oliveira S., Varanda C.M.R., Clara M.I.E.;
RT   ;
RL   Submitted (02-JUN-2005) to the EMBL/GenBank/DDBJ databases.
RL   Sanidade Animal e Vegetal, Universidade de Evora, Apartado 94, Evora
RL   7002-554, Portugal
XX
CC   On Oct 23, 2005 this sequence version replaced gi:51828816.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3702
FT                   /country="Portugal"
FT                   /db_xref="taxon:47669"
FT                   /mol_type="genomic RNA"
FT                   /organism="Olive latent virus 1"
FT                   /isolate="GM6"
FT                   /specific_host="Olea europaea L. (olive)"
FT   CDS             61. .2235
FT                   /codon_start=1
FT                   /note="readthrough stop codon"
FT                   /transl_except=(pos:667. .669,aa:OTHER)
FT                   /product="RNA dependent RNA polymerase"
FT                   /protein_id="AAZ43259.1"
FT                   /translation="MELPNQHKQTAAEGFVSFLNWLCNPWRRQRTVNAAVAFQNSILAI
FT                   EDVEHFEDINECFEESSGGQSQRTKVVAEGAYSPVKSERTRRVRKQKKAKFVKYLVNEA
FT                   RAEFGLPKATEANRLMVQHFLLRRCKDWGVVTSQCHNNVALALTLVFVPTEDDLLARAM
FT                   MNTYKTRSAVRGMDNLQGEGWWNNRLGIGGQAGWAFRAKXGCLERRPGFSTSVSRGNHP
FT                   DLVVKPSGHPEKQRQLLRYSGIGGHLLIGIHNNSLSNLRRGLMERVFYVEGPNGLQDAP
FT                   KPVRGAFNSLNKFRDLYTKNSWRHSPVTNEQFLMNYSGRKLTIYKEAVDSLSHQPLSLR
FT                   DSRLKTFVKAEKLNLSKKPDPAPRVIQPRSPRYNVCLGRYLRHYEHHAFKTIAKCFGEI
FT                   TVFKGFTLEQQGEIMFSKWKKYVNPVAVGLDASRFDQHVSVEALQYEHEFYIRDYPNDK
FT                   QLKWLLKQQLSNIGTAFASDGIIKYKKEGCRMSGDMNTSLGNCILMCAMVYGLKEHLGI
FT                   NLSLANNGDDCVIVCEKADLKKLTSSIEPYFRQFGFKMEVEQPVDIFERIEFCQTQPVF
FT                   DGYQYIMVRKPSVVTSKDVTSLIPCQNQAQYAEWLQAVGECGMSINGGIPVMQNFYHML
FT                   QTGVKRTKFTKTGEFQTNGLGYHSRYMHRVARAISPETRLSFYLAFGITPDLQEALEAF
FT                   YDTHTLELDDVVPVDTYQVSGEHLINGLPN"
FT   CDS             61. .669
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AAZ43260.1"
FT                   /translation="MELPNQHKQTAAEGFVSFLNWLCNPWRRQRTVNAAVAFQNSILAI
FT                   EDVEHFEDINECFEESSGGQSQRTKVVAEGAYSPVKSERTRRVRKQKKAKFVKYLVNEA
FT                   RAEFGLPKATEANRLMVQHFLLRRCKDWGVVTSQCHNNVALALTLVFVPTEDDLLARAM
FT                   MNTYKTRSAVRGMDNLQGEGWWNNRLGIGGQAGWAFRAK"
FT   CDS             853. .2235
FT                   /codon_start=1
FT                   /product="p52"
FT                   /protein_id="AAZ43261.1"
FT                   /translation="MERVFYVEGPNGLQDAPKPVRGAFNSLNKFRDLYTKNSWRHSPVT
FT                   NEQFLMNYSGRKLTIYKEAVDSLSHQPLSLRDSRLKTFVKAEKLNLSKKPDPAPRVIQP
FT                   RSPRYNVCLGRYLRHYEHHAFKTIAKCFGEITVFKGFTLEQQGEIMFSKWKKYVNPVAV
FT                   GLDASRFDQHVSVEALQYEHEFYIRDYPNDKQLKWLLKQQLSNIGTAFASDGIIKYKKE
FT                   GCRMSGDMNTSLGNCILMCAMVYGLKEHLGINLSLANNGDDCVIVCEKADLKKLTSSIE
FT                   PYFRQFGFKMEVEQPVDIFERIEFCQTQPVFDGYQYIMVRKPSVVTSKDVTSLIPCQNQ
FT                   AQYAEWLQAVGECGMSINGGIPVMQNFYHMLQTGVKRTKFTKTGEFQTNGLGYHSRYMH
FT                   RVARAISPETRLSFYLAFGITPDLQEALEAFYDTHTLELDDVVPVDTYQVSGEHLINGL
FT                   PN"
FT   CDS             2219. .2440
FT                   /codon_start=1
FT                   /product="p8"
FT                   /protein_id="AAZ43262.1"
FT                   /translation="MDYQTEVSEDNVSVRGRARRGTEDKKHNGSGLTGVKRHAVSETSQ
FT                   KSQQGTGNGTMTNIAEEQTITVTYNFNF"
FT   CDS             2443. .2613
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="AAZ43263.1"
FT                   /translation="MAVCRCCDTSPGITLFPYFAILILILAILVVGTPNQQYHHSPSTY
FT                   EYKTQHISIAK"
FT   CDS             2635. .3447
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AAU09671.1"
FT                   /translation="MVNYYWDSRIQRWFYESGPQRVRTYMKADFTPPNGKLPARKTKRS
FT                   PPNRGNLQVLPVTAPAAGGVISTRRRVPRITTTNEQTVVRNTEIISAINSAALGAFSAT
FT                   TVTVIPSNLSWLAGLSDLYSKYRWRKLRFIYIPVCPTSTQGNVSMSLSFDRIDAQPTSI
FT                   TQMQQGYRAITFPPYAGYDGAMALSSFGNIPGMVVVDVDCARMDKLWYPNVTLATFLAM
FT                   ATNIQNGYCGVTLSTASDQGPAAATNFGQVFCQYEIEFIEPVNPTVNV"
XX
SQ   Sequence 3702 BP; 1003 A; 879 C; 910 G; 910 T; 0 other;

DQ083996  Length: 3702  November 1, 2005 08:47  Type: N  Check: 2097  ..

       1  tagtatacat accaagtata cgataccggt gcaagcccgt acacagctaa
      51  agtgtctaaa atggagttac ccaaccaaca taagcaaact gctgctgaag
     101  gtttcgtttc tttccttaac tggctttgta atccctggag acgtcaacgt
     151  acagtcaacg ctgctgtcgc ttttcagaat agcattcttg ctattgagga
     201  cgtggaacat ttcgaagata tcaacgaatg tttcgaggaa tcatctggag
     251  gccaatcgca gcgcactaag gttgtcgctg aaggggctta ttctcccgta
     301  aaatccgaac gcacccgccg agtccgcaag caaaagaagg ccaaattcgt
     351  caaatatttg gttaatgagg ctcgtgccga gtttggtctc cccaaagcta
     401  cagaggccaa tcgactcatg gtgcaacact tcctgctccg aaggtgtaag
     451  gattgggggg ttgtcacatc ccagtgccac aacaatgttg cactcgcctt
     501  gactctcgtg tttgtcccaa cagaggatga tttgctggcg cgagctatga
     551  tgaacacgta caagacgagg tctgcggtcc gtggtatgga caacctccaa
     601  ggtgaggggt ggtggaacaa caggcttggc ataggtggcc aggccggctg
     651  ggcctttcgg gccaagtagg ggtgcctaga gaggaggccg gggttttcca
     701  cgtctgtttc gcgtggaaac caccccgatc tggtggtcaa accatcagga
     751  caccccgaga aacagcgtca gttgttacgc tatagtggaa ttggcggcca
     801  tttattaatc ggcatccaca acaactctct ctccaacttg cgtaggggct
     851  taatggagag agtattctac gttgagggac ccaatgggct ccaagacgcc
     901  cctaaacccg ttcggggggc attcaactcc ctgaataagt ttcgagacct
     951  atataccaaa aatagttggc gtcattcccc tgtaaccaat gaacaattct
    1001  tgatgaatta ctcgggcagg aaactaacta tttacaaaga agcggttgat
    1051  agtttgtcgc atcaaccact tagcttacgg gactcgaggc tgaagacttt
    1101  cgttaaggcc gaaaaactta atctgagcaa gaagccagat ccagcacccc
    1151  gggtcattca acccaggtca cctcggtaca acgtttgttt gggtcgttat
    1201  ctacgtcact atgaacacca cgcgttcaaa accattgcta aatgctttgg
    1251  ggagatcacg gtctttaaag ggtttactct agagcaacaa ggcgaaatca
    1301  tgttttcgaa gtggaagaaa tatgttaatc ccgtcgccgt tggactcgat
    1351  gcaagtcggt tcgaccaaca cgtgtcagtt gaagcacttc aatatgagca
    1401  tgaattttac attagagatt acccgaatga taaacagcta aaatggttgt
    1451  taaagcaaca actgagcaat attggcacag cgtttgctag tgatggcatc
    1501  ataaagtaca agaaggaggg ttgtcgtatg agtggagata tgaacaccag
    1551  tttgggcaat tgcattctca tgtgtgcgat ggtctacggg ttgaaggaac
    1601  acctgggcat aaatttatcc cttgccaata atggggatga ctgcgtcatt
    1651  gtctgtgaga aagcggattt gaagaaattg acaagcagca tcgaaccata
    1701  ttttaggcaa tttggattca aaatggaggt ggaacaaccc gtagatatat
    1751  ttgagcgcat tgagttttgt caaacccaac ctgtgttcga tggctaccaa
    1801  tacatcatgg ttcgaaaacc ctcggtagtc acttcgaagg atgtcactag
    1851  cttaatccca tgccagaatc aggctcaata tgcagaatgg ctgcaagctg
    1901  tgggtgagtg cggaatgagt atcaatggtg gaatacctgt tatgcagaac
    1951  ttttaccata tgctccaaac tggagttaaa cgcaccaaat tcaccaagac
    2001  cggcgagttt cagacgaacg ggttggggta tcactctaga tatatgcata
    2051  gagtggcccg agccatttcg cccgaaaccc gtttatcctt ctatttagcg
    2101  ttcggtatca caccagacct tcaggaagca ctggaggcct tttatgatac
    2151  ccatacgctt gagttggatg atgttgtccc agttgatacc taccaagtat
    2201  caggagagca tttgatcaat ggattaccaa actgaggtta gtgaggataa
    2251  cgtgagcgta cgcggtcggg ctaggagggg cactgaggat aagaagcaca
    2301  atggatcggg attaactggc gttaagcgtc atgcggtgag tgaaacatct
    2351  cagaaatcac agcaaggtac tggcaacggc acgatgacca acatagctga
    2401  agagcagacc attaccgtga catacaactt taacttttag ttatggctgt
    2451  gtgtcgctgt tgtgatactt caccaggtat tacattattc ccttactttg
    2501  ctattctcat tctcatcctt gcaatattag ttgttggaac tccaaaccag
    2551  caatatcatc attctcctag tacttacgag tataagactc aacacatttc
    2601  gatcgcaaaa tagacatttc gcaactctct caacatggtt aattattact
    2651  gggatagtcg aattcagagg tggttctacg aaagtggacc acagcgtgtc
    2701  cgaacatata tgaaagcgga tttcacccca ccaaacggca aactgcctgc
    2751  ccgcaagact aaaaggtcac ccccgaatag gggcaacctc caggttcttc
    2801  cggttacagc acccgctgct ggtggagtga tctccacaag aagacgcgtt
    2851  cctcgaatta ctactactaa tgagcagact gtcgtgagaa acacagaaat
    2901  cataagtgcc attaactctg ccgctctagg tgcattttcg gcgaccactg
    2951  tcacggtgat cccgtccaac ctctcatggt tggcagggtt gtccgatttg
    3001  tacagcaagt accgttggcg caagctccgg tttatttata ttccggtctg
    3051  cccaaccagc acacaaggca atgtctctat gtcactatca ttcgacagaa
    3101  tcgatgcgca gccaacaagc atcactcaaa tgcaacaggg ctaccgtgcc
    3151  atcacgttcc cgccttacgc ggggtatgat ggtgctatgg ccttgtcgtc
    3201  cttcggcaac attcctggaa tggttgtcgt cgatgtggac tgtgcacgaa
    3251  tggacaagtt gtggtatcct aatgttaccc tggccacctt ccttgccatg
    3301  gcaactaaca tccagaacgg atattgcgga gtaaccctgt ccactgcaag
    3351  tgatcaaggg ccagccgccg ccactaactt tggccaagtg ttctgccagt
    3401  acgaaatcga atttatagaa ccagtgaacc caactgtcaa tgtgtaacca
    3451  cacaacgatg ggtgagttgc gtaactgtgt caattcctaa aggttttagt
    3501  agagcggtaa gcaagacgga tcctgggaaa caggtttaac gggctggggg
    3551  tggtgccccg gccgtcgcat cacttgctga tacaatctac aaggcccatg
    3601  gaagggtctg cacaggtatc cacgccaagg acggggcgaa agtctcggac
    3651  ggggggtagt ggacccaaca ccagattgag gggcttttgc cccacccccc
    3701  cg