Sequence of DPV Eggplant mottled crinkle virus

Eggplant mottled crinkle virus ORF1-RT gene, partial sequence; and RNA polymerase gene, complete cds.

ACC No: DQ090837

Dated: 2005-07-21 | Length: 1008 | CRC: 1201589249

                !!NA_SEQUENCE 1.0
ID   DQ090837   standard; genomic RNA; VRL; 1008 BP.
XX
AC   DQ090837;
XX
SV   DQ090837.1
XX
DT   21-JUL-2005 (Rel. 84, Created)
DT   21-JUL-2005 (Rel. 84, Last updated, Version 1)
XX
DE   Eggplant mottled crinkle virus ORF1-RT gene, partial sequence; and RNA
DE   polymerase gene, complete cds.
XX
KW   .
XX
OS   Eggplant mottled crinkle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1008
RX   DOI; 10.1007/s00705-004-0331-x.
RX   PUBMED; 15593416.
RA   Koenig R., Verhoeven J.T., Fribourg C.E., Pfeilstetter E., Lesemann D.E.;
RT   "Evaluation of various species demarcation criteria in attempts to classify
RT   ten new tombusvirus isolates";
RL   Arch. Virol. 149(9):1733-1744(2004).
XX
RN   [2]
RP   1-1008
RA   Koenig R.;
RT   ;
RL   Submitted (09-JUN-2005) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land- und Forstwirtschaft, Messeweg 11,
RL   Braunschweig D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1008
FT                   /db_xref="taxon:270256"
FT                   /mol_type="genomic RNA"
FT                   /organism="Eggplant mottled crinkle virus"
FT                   /specific_host="eggplant"
FT   5'UTR           1. .71
FT   misc_feature    72. .>1008
FT                   /note="similar to ORF1-RT encoded by NC_004723"
FT   CDS             72. .962
FT                   /codon_start=1
FT                   /note="similar to NC_004723"
FT                   /product="RNA polymerase"
FT                   /protein_id="AAZ08583.1"
FT                   /translation="MDRLLNFLRPKRELFVGDFAIGVDRRPSVDMFQLVCRLALRYMRT
FT                   GKIECNVDSLQQFVVELLKTDCAAKWEWFMKRRSAGDYAIPLALAALPIAPLLSYTTKV
FT                   RTVSVKAFGNELTFPFRTLRPSLPRKGLLLRLAAGFALAPVCLLAVYATLPREKLSVFR
FT                   LRTEARTHMEDEREATECLVVEPARELKGKDGEDLLTGSRMTKVIASTGRPRRRPYAAK
FT                   VAQVARAKVGYLKNSPENRLIYQRVIIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSSESLGVK"
XX
SQ   Sequence 1008 BP; 244 A; 205 C; 303 G; 256 T; 0 other;

 DQ090837  Length: 1008  August 1, 2005 11:49  Type: N  Check: 9435  ..

       1  cggaccagct acgggtttga agggtgagcc tattcttcgg aagggtaaat
      51  tgtaactttc accaataagc aatggataga ttactgaact ttctgagacc
     101  taagagagaa cttttcgtag gtgattttgc gatcggggtt gacaggaggc
     151  catcggtgga catgttccag ttggtgtgta ggttggctct cagatatatg
     201  aggacaggga aaatcgagtg caatgtggac agtcttcaac agttcgttgt
     251  tgagttgtta aagactgatt gcgcagccaa atgggaatgg ttcatgaaac
     301  ggcgttctgc cggtgattat gctatccccc ttgcactggc tgcactaccc
     351  attgccccgc tgttgagtta taccacaaag gttagaacgg tgagtgtaaa
     401  ggcgttcggg aatgaattga ctttcccatt caggaccctt cgcccaagct
     451  taccccgtaa gggtttgctc cttcggctgg cggccggctt tgcgttagca
     501  cctgtatgct tgcttgctgt gtacgctacc ctgccacggg aaaaactgtc
     551  tgtatttagg ctgagaactg aggcccgcac acatatggag gatgagaggg
     601  aagcaacgga atgtttggtg gtagagccag ctcgagagct caagggaaag
     651  gacggggagg atctcctcac tggtagtaga atgacaaagg taattgcgtc
     701  tacagggcgc cctcgcagga gaccttatgc agcgaaagtt gctcaggttg
     751  caagagctaa ggtgggttac cttaagaata gtcctgagaa tagattaatc
     801  taccagagag tcatcattga gatcatggac aaggattgcg tcaggtatgt
     851  tgacagggat gtcatattgc ctttggctat tggatgttgt tttgtctacc
     901  cggacggagt ggaagagtcg gcggcactct ggggctcgag cgagtccctg
     951  ggtgtgaaat agggaggcct agtgcgtcta cctggggttg tgacacagac
    1001  caatcgag