Sequence of DPV Citrus tristeza virus

Citrus tristeza virus strain T318A, complete genome.

ACC No: DQ151548

Dated: 2006-01-28 | Length: 19252 | CRC: -849515663

                
ID   DQ151548   standard; genomic RNA; VRL; 19252 BP.
XX
AC   DQ151548;
XX
SV   DQ151548.1
XX
DT   28-JAN-2006 (Rel. 86, Created)
DT   28-JAN-2006 (Rel. 86, Last updated, Version 1)
XX
DE   Citrus tristeza virus strain T318A, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19252
RA   Ruiz-Ruiz S., Moreno P., Guerri J., Ambros S.;
RT   "The complete nucleotide sequence of a severe stem pitting isolate of
RT   Citrus tristeza virus from Spain: comparison with isolates from different
RT   origins";
RL   Arch. Virol. 151(2):387-398(2006).
XX
RN   [2]
RP   1-19252
RA   Ruiz-Ruiz S., Moreno P., Guerri J., Ambros S.;
RT   ;
RL   Submitted (01-AUG-2005) to the EMBL/GenBank/DDBJ databases.
RL   Proteccion Vegetal y Biotecnologia, Instituto Valenciano de Investigaciones
RL   Agrarias, Ctra Moncada-Naquera Km4,5, Moncada, Valencia 46113, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19252
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Citrus tristeza virus"
FT                   /strain="T318A"
FT   5'UTR           1. .107
FT   CDS             108. .9455
FT                   /codon_start=1
FT                   /product="p349 protein"
FT                   /protein_id="ABA43375.1"
FT                   /translation="MSKLGARFKSSTFAVRSDYIISRIWRAFNTVGVLHFFGTETTTKV
FT                   VKEFSAPMPIVPLRKSCFPFSVRAAVRAIKAAGRPIDAPRSGCLCGLPVIDTSGVVRPR
FT                   SVAGIWRYSLCKPPLTAAAKKSIRKAKKDSAFFLSRASSLFSREVPCGTRHRLRRRVME
FT                   RVDPTMHESPQDEIRHKGRRHGKTSDLPYMGEAALDDILRWIEGVNPPPSMVAIPVPIT
FT                   FGAVPTTAWCSPADAAVLRCRIDYHAAETSFRDEGKHVRYVYNDVSSAANRPRTVSPRK
FT                   CGRVFPSGSALGVEVPSTRDRHTAFVRSTHASVFFSDAVRRVRMFRPGRNNFFTSVVSG
FT                   RRVSYFRPGPNGTVSILMSDGVNTARLDVVAPAYYAYAKALGAKVRCLWESSDLDDAKI
FT                   RDGQCYVRHVYDVALYFGRRVDLSVRRTLGLFPTVGALKAYLVREYGRESLKVPMRGTY
FT                   TFGSVFHCLSTKSCVDLRSIPNHHLVGGASAHVFIGQIRVDVPGGVSKPSRAAVRRRNR
FT                   RLREDGFLGSTDSSSSGGSRYCSDCSTPRSPPSPSIVGPTLGRIPSINRKFRFPAGTQL
FT                   SVSIPKRDDDRVYVSVGQDFDELCHAVCTYVKRYNSRKAFYTRFENGDDFAVIRRASVG
FT                   GLHVFVKRGNFTARFPMSASRYEHHYDASMKGAGLSWVRKSRFPNVEVIRRRRSRTGGS
FT                   LASFPDANLRISPDQPSDSVQAVPVSGENSPSSRGASSPRRDTVEGSGWYKVGSPSHHS
FT                   SAARGQRSIERGKIGDFSFPSSTVYNARVDERAYKRVLKLRDTSASSFLRIVLARLSSY
FT                   RPLSDEFFNKCVTSRFVACIEAVESGLVTVHFRSDVFRASFPFGVYLYTRHAFDIYSGK
FT                   LLNLDRYGFSEDLKDGYCYIRHIAEVCLSMGKVFFRRDVNLGAFPYVFEVQHRLVRLYG
FT                   KRAVEYGVRGYFSATRLYHCCFTDSPRPFKSLNKYHKMGGEEGALLITDTDRLRAVGSA
FT                   YEKVKGRLPDSLLVRSVEKDLIEFNQTLVDTQRARPGVAVPFQMSENQQVMLTRAYPEF
FT                   NINFTHSVHSDHPVAAGSRMLENHLVRKSAGSDYSDVGGCPLFHLRAGHTGVHVCRPVY
FT                   DIKDAHRRVVRHHQLSKVAFDHTDGSKQVGAVNTNTVCGNVLGECFHASDAIVMVQVYD
FT                   VPLRELCRAMVNKKASVCYMTVVTPGELLDARESFFIKELDCSVELDAVADRVVYCFNN
FT                   SAYTHTYSTICEYMRTPCVVVDGFLFTIEMVSLRCSVNYYCITKSRVCPRISEIKRLRY
FT                   RRCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFEWTW
FT                   NYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLAAFSGD
FT                   TSLFELVRFAISEKCRDLFVGIQEAVERCVKSYLRNSFNMSFVDLSDPLLTISEYSELD
FT                   VPIDLPGFGCIAEEDEAKLIEDGVKSALLRKAVRDEAQLILERGGTSEIVPCGDEESLG
FT                   GDGSDSLLGSGSDSPSNASSGGLRAGAAPSLFRSLLKKLGGGFCMAKRLLDLLCERLVA
FT                   SLSRLKFGTTHLTSFFSVLRIKLSRNFFDDSIFAAVWDTVMNLIRIVNGVTKTKLECFR
FT                   NVLRLIPKLCSGCKDLAKDFADMCRLVFLLSTEFFSKSYAKLCRFSLEIFDIGLIEISA
FT                   RNMGLETCVSMASAIFDVILTYPLGSVSFPIVCARVFGALAMEVGSNYCFKKTFGKPEI
FT                   LGEDAFRRTVSMVLSAKAFDKLSVDGKGLVRCSGVIPGILRIVFSSLFSDADAWVGYSK
FT                   HEVSSLPIVTYSTKRLSFVLEQTKEACVAFIVDSSKKILASLTSEIHESFQNSELTSGA
FT                   KSLYGHVSSILSASNGVVNKAGNAVAAVKAAGSGLSKRVRRIRPSFRLARCVNEQTSEY
FT                   YSASDESELDESLLSDTPGLRGNGKCCDLFRVVSGRVSVCCRHAVEALRRLALHVGDYL
FT                   YSCIMDSFVRLFVRTNTAVGKCESFAVDCATKISDLVVGYIAWRNLHSGAYSTTPGLSG
FT                   GSRNSLSRFLDGGLMCVIQNFVTAWQTVFNETFYSSLAHRMRTASINVLLEFLKNLPVC
FT                   LVSIYTFIECRSRIFPLKEFLWGFCVFVWNIVKELSICIYGNLPVCVTRLCNRAFRRSS
FT                   NEGDVRTLQVITEAENRIEFLREVLAEMARYRASLEIPVPGSPDSPLFPPTYGEIEELG
FT                   NDSSDSARLIGVDNGSDSVSTEGEAELDSDGDSDDSIPLDRDFEQIGGLGGSGNVDVFR
FT                   LGLRFVWRMLRNLFNLRAVKFSYGLALQCIFNGGSMGQFTSRLLFSFGNCLPFEFFRHV
FT                   CSVRWLSKSLALRVRNASVCDEETVEYFFSFSRFLYDSRYLSDVFSVLERVDFYLSYLL
FT                   SLPKRCLTRNRSVRVCARAPVRVIRDVGVVEDGKKSLTEVLNSLDSLKVSDRKGKSALI
FT                   ESDNSDSESGHSFGSISFGSVNEEVLEAVNGGVVSEKAPLMKHAAALSRLEPDLSGNKD
FT                   LPIVRRSFTRGESSGTKPAGSLCVYLTTLNSSFGSVPDLYPVARDITYKKMTNAMREFY
FT                   YSQKVTLYELHGKLSSYWDELKTVGFDRKLAKMDLDDDVSVVDFNLKVIVGRHGTRPFR
FT                   NTVNSHEFMFCDDGLVLCPGPKKRDFALISSQTQFVAANSFLRAVDGKDLTFTNSEHSL
FT                   IVYEAPPGGGKTHSLVKYFADYCTKVSCLVVTANKNSQAEISQRISRELMDRKMLAKHV
FT                   VKTAGRVFTVDSYLMNHIRLKTDLLFVDECFMVHAGAIGAVVEFTSCKAVVFFGDSRQI
FT                   HYIHRNDFGVSLLHDIDAFIEPQHRIYGEVSYRCPWDICEWLSKFYPRHVATANTGSIG
FT                   KSSVSIEIINGCDDVPYDSSAKYIVYTQAEKNELQKHLGRLTVGRTKAVPIVNTVHEVQ
FT                   GETYKKVRLVRCKYQEDTPFCSDNHVVVALTRHVDSLTYSVLNSRRYDKTASSIDEARE
FT                   IFDKFRSTNHSHGSSTLEWYLEKYPTEYKGSKASSAPLSCINEFLNEVVVGSSVVQLGD
FT                   TSEELSSRPFESGCDNITVRDTAPPDSGNLHEPARVRRGKVASNSAKKSVPTRKSSVVR
FT                   KS"
FT   CDS             <9379. .10812
FT                   /codon_start=1
FT                   /note="start codon not determined; likely expressed by +1
FT                   ribosomal frameshift"
FT                   /product="RdRp protein"
FT                   /protein_id="ABA43376.1"
FT                   /translation="GVVRSQAIPPRKASLQENLLSYESRNYNFIKTERFVGPENFGRAM
FT                   AAAVIERCFRMDEVAKIRSDIIALTEANIQKWLDKRTPCQVKSVQAELKLPFDVEEQIT
FT                   NYKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIYSPCFDEFKNRVLSSLNGNIV
FT                   FFTEMTNAGLAEVIRRIIGDDDNLFVGEVDFSKFDKSQDLFVKEYERALYSEFGFDDEL
FT                   LDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLVTLGILSLYYDVSKFELL
FT                   LISGDDSLIYSKEKISNFSSEICLETGFETKFMSPSVPYFCSKFVVQTGNKTCFVPDPY
FT                   KLLVKLGAPQYKLTDDELFELFTSFKDITQDFGDQVVLEKLKLLVETKYGFTSGTTMPA
FT                   LCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFANLICERVVYDNRVGYFSYFD
FT                   NPFAKPDASDGQADDLATG"
FT   CDS             10861. .11772
FT                   /codon_start=1
FT                   /product="p33 protein"
FT                   /protein_id="ABA43377.1"
FT                   /translation="MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDR
FT                   DPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKT
FT                   VDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENL
FT                   NNVCSSSFFFRAVSETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNANLG
FT                   DSSGVQSRTIEEEGYRTDTAGNVAVTVPNTPLVNAVSPYVAEYNENTRSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLSIIFI"
FT   CDS             11842. .11997
FT                   /codon_start=1
FT                   /product="p6 protein"
FT                   /protein_id="ABA43378.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNASPY
FT                   GTHVTV"
FT   CDS             12003. .13787
FT                   /codon_start=1
FT                   /product="p65 protein"
FT                   /protein_id="ABA43379.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTEKNYQSYLHKLSPSYKVIVKEFGIKSMP
FT                   VPYLSPLNNDLGLSVALPSLIALYTKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSVSLSGYTCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELADFLPQKELNVSSLKEALSLQTDPVKYTVTHYG
FT                   MSETVSIDQTTLREIASVFITRTIDILTQVKAKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LETVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSHYDYVGMPHPTRKLLRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDTLLADLRKTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERVPL"
FT   CDS             13711. .15327
FT                   /codon_start=1
FT                   /product="p61 protein"
FT                   /protein_id="ABA43380.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRNFDERNVSLDHTLSSG
FT                   VVVRRQNLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSLMTGVEDRKIPDELISV
FT                   DPHEVGCRFTLNDVESYLISRGEDSADVTAVEHSWCLSNSCGRLLSSTEIDTYKTMVFT
FT                   KTFNSGVFGVTTKLETYLSYCISLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   CTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   TLVPFDPTDFVLDIPKLNIHDTMVVVGNQIRHLEHVVESDALDDLSQHVDLNLAADNPD
FT                   LRVDLRWAGMFVYYGIYRCAVHRVVERPALFNLPRKLLNQDDGESCLLRMSSVETLFNL
FT                   VQKVNKDINIRRQFMGRHSKVALRLYRNLGLKFPPISSVRLPAHHGYLYVDFYKRIPDN
FT                   AVDADELESLRQLRSSVDVMCKDRVSITPPPFNRHRRGSSRILRGRGARGASSRYMSRD
FT                   VATSGFNLPFHHGGLHDASQN"
FT   CDS             15296. .16018
FT                   /codon_start=1
FT                   /product="p27 protein"
FT                   /protein_id="ABA43381.1"
FT                   /translation="MAGYTMLPKTDDKEMDPVSAAVPGKYPDVIEKFVTNRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEQLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLMDKVVFPFIISKFTDRETPNALRKYACAFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLTGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16110. .16781
FT                   /codon_start=1
FT                   /product="p25 protein"
FT                   /protein_id="ABA43382.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYVQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16747. .17250
FT                   /codon_start=1
FT                   /product="p18 protein"
FT                   /protein_id="ABA43383.1"
FT                   /translation="MSGSLGNLTHVDLLRSESRFLSGWWSFVVNVGDIIVRFALHVPSE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVIMGTNVDDSRCGCSIWFYNNGTFLNGLTRCNNLVAL
FT                   FSAT"
FT   CDS             17284. .17643
FT                   /codon_start=1
FT                   /product="p13 protein"
FT                   /protein_id="ABA43384.1"
FT                   /translation="MGIRRVWLKIMAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NASYAKKCYELANFDLDFLRIVIIPLSGGAVNESRADRANVSEIVESHMSDRDRMKILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             17719. .18267
FT                   /codon_start=1
FT                   /product="p20 protein"
FT                   /protein_id="ABA43385.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMSSSHTSFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
FT   CDS             18350. .18979
FT                   /codon_start=1
FT                   /product="p23 protein"
FT                   /protein_id="ABA43386.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTEIKTVSSEADRLEFLRKMNPFI
FT                   IDALIRKNSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMYTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           18980. .19252
XX
SQ   Sequence 19252 BP; 4748 A; 3805 C; 4905 G; 5794 T; 0 other;

dq151548 Length: 19252  28-JAN-2006  Type: N  Check: 8317  ..

       1  aatttctcaa attcacccgt accctccgga aatcacgtcc ggacgctgcg
      51  ggaatcggtg taaatcccgg caaattgccc cactacgccc atacaaacaa
     101  caacaatatg tcgaaactcg gagctcgctt caagtcctcg actttcgctg
     151  tacgcagcga ttacatcatc tcgcgcatct ggcgcgcctt taacaccgtt
     201  ggagtcctgc acttcttcgg tactgaaaca accaccaagg tggttaagga
     251  gttttcggcc cctatgccga tagtcccttt acggaaatcc tgttttccgt
     301  tttctgttcg cgctgctgtt cgcgcgatta aagctgccgg acgtcctatt
     351  gacgctccgc gctccggatg cctctgtggc ctccctgtta tcgacacatc
     401  tggtgtcgta cgtccccgct ctgtcgcggg catttggagg tattctctgt
     451  gtaaacctcc ccttactgcc gccgccaaga agtccattcg caaggcgaag
     501  aaagattctg ctttctttct tagccgggct tcttcactct tctcacggga
     551  agtcccctgc ggcacgcgtc atagacttcg taggcgcgtc atggaacgag
     601  tagaccccac catgcacgag agtccccaag acgagatcag acataaggga
     651  cgccgacatg gcaagacttc tgacctcccg tatatggggg aagcggcgtt
     701  ggatgatatc cttcgctgga ttgagggggt aaatcccccg ccgtcgatgg
     751  tcgccattcc ggtgcccatc actttcggcg ccgtgcccac tacggcatgg
     801  tgctctcctg ctgacgcggc tgttctacgg tgtcgcatag actaccacgc
     851  cgctgagact tcctttcgtg acgaagggaa gcacgtaaga tacgtctata
     901  atgacgtgtc ttctgctgcc aaccgtcctc gtacggtttc tccccgcaag
     951  tgcgggcgtg ttttccccag cggttctgcg ctgggtgttg aggtcccgag
    1001  cactagggat cgccataccg ctttcgtgag atctactcac gctagcgttt
    1051  tcttctccga cgcggttcgc cgcgttcgca tgttccgtcc tgggcggaat
    1101  aatttcttca ctagcgtcgt cagtgggcgg cgcgttagtt actttagacc
    1151  cggacctaat ggtacggtgt ctattttaat gtcggacggt gtcaacacgg
    1201  cgcgtctcga cgttgtcgct cctgcgtact atgcgtacgc taaagcttta
    1251  ggcgccaaag tgcgctgttt gtgggagtcg tccgatttgg acgatgctaa
    1301  aatacgtgac ggccaatgct atgttcgtca cgtgtacgac gtggcccttt
    1351  acttcggaag gcgcgtcgat ctttctgtgc gccgaacttt gggtttgttt
    1401  cccacagtgg gtgcactaaa agcttatctt gttcgcgagt acggtcgcga
    1451  atctttgaag gttccgatgc gcgggactta cacttttggc agtgtatttc
    1501  attgcctgtc gactaaatct tgtgtcgact tgagatctat tcctaaccat
    1551  cacttggttg gtggtgcgtc tgctcacgtg tttattgggc agattcgtgt
    1601  tgacgttcct ggtggcgtct ctaagccatc acgagcggct gttcgcaggc
    1651  gtaataggcg tttgcgtgaa gacgggtttt taggtagtac cgattcgtct
    1701  tcttcaggag ggtcgagata ctgttcggat tgttcaactc ctcgcagtcc
    1751  accctctccg tcgattgttg gaccaactct tggccggata ccaagtataa
    1801  accggaagtt ccggtttcca gcaggcactc agttgagtgt ttctatccct
    1851  aaacgcgatg acgatcgcgt gtacgtgtcg gtcggccaag actttgatga
    1901  gttgtgccat gccgtgtgta cctacgttaa gaggtacaac tcgagaaaag
    1951  ctttttacac gcggtttgaa aatggtgatg atttcgccgt cattcggcgt
    2001  gcttccgtcg gaggtcttca cgtgttcgtg aaacgcggca actttacggc
    2051  tcggttccct atgtcggctt caagatatga gcatcattat gatgcaagta
    2101  tgaaaggcgc cggtttgtcg tgggtgcgga agagtcggtt tccgaatgtt
    2151  gaagttatac gccgtcgaag gagtcggacg ggcggttctt tggctagctt
    2201  tccggacgcg aatttacgga ttagtcctga ccaaccgtcg gattctgttc
    2251  aagcagttcc ggtgtcgggt gagaattctc catcgtctcg aggggcgtct
    2301  tcgccccgac gtgatactgt tgaagggtcg ggctggtata aggtgggttc
    2351  tcctagtcat cactcgagtg ccgctcgtgg gcaacgttcc attgaacgtg
    2401  ggaagattgg ggatttcagt tttccgagta gcaccgtgta caatgcacgt
    2451  gtagacgagc gtgcttataa acgtgtcttg aaattgcggg acacgtcggc
    2501  gtcctctttt cttcgtatag ttttggctcg tttgtcgagt tatcggcctc
    2551  ttagtgacga gttctttaac aagtgcgtta cttctcggtt tgtagcttgt
    2601  atcgaggcgg ttgaatcggg tctcgttaca gtacactttc gatccgacgt
    2651  gtttcgcgcc tcgttcccgt ttggcgttta tttgtatact cgtcacgcat
    2701  ttgatattta cagtggtaag ctcctgaatc tagataggta cgggttttcg
    2751  gaagacctga aggacggtta ctgctatatt cgtcatattg ctgaggtctg
    2801  tttgagtatg ggaaaagttt tctttaggag ggacgttaat ttaggggcgt
    2851  tcccttatgt tttcgaggta caacaccgtc ttgtgcggtt gtatggtaag
    2901  cgggctgttg aatacggcgt tagaggttat ttttcagcaa cgcgtcttta
    2951  ccactgttgc tttaccgatt caccgagacc cttcaaatca ttaaataagt
    3001  atcataagat gggtggtgaa gaaggtgcgt tattaatcac tgacactgat
    3051  aggttacgtg ccgtggggag tgcttacgag aaggtgaagg ggcgtttgcc
    3101  cgattcttta ctcgttcgat cagtggagaa agatttgata gaattcaatc
    3151  aaactctggt tgatacgcaa cgggctagac ccggtgttgc ggtgcctttt
    3201  cagatgagtg agaaccaaca ggtgatgctc actagagctt atcctgagtt
    3251  taatataaac tttactcatt ccgtacactc cgatcacccc gtcgctgcgg
    3301  gttctagaat gttagagaat caccttgttc gtaaatccgc aggtagcgat
    3351  tattcggacg taggtggttg cccattattt catttacgtg cgggtcatac
    3401  aggagttcac gtttgcagac cagtgtacga tattaaagac gcccaccgta
    3451  gagtcgttcg tcatcatcag cttagtaaag tagcttttga tcatactgac
    3501  gggtctaagc aagttggtgc tgtcaatacg aacaccgtgt gcggcaacgt
    3551  tttaggggag tgtttccatg cgtctgatgc gattgttatg gtgcaagttt
    3601  atgacgtgcc attgcgagaa ttgtgtagag ctatggtgaa caagaaagct
    3651  tcggtgtgtt atatgaccgt ggttacgccc ggtgagttgt tggacgcccg
    3701  cgagtctttc ttcatcaaag agttagactg ttcggtggag ttggacgctg
    3751  tcgccgatag ggttgtttac tgctttaaca attcagcgta tacgcatacc
    3801  tattctacga tatgcgaata catgcgtact ccttgtgtgg tggtggatgg
    3851  ttttctgttt actatagaga tggtttcact cagatgtagc gttaactatt
    3901  attgtatcac caaatcgcgg gtttgtccga gaatcagcga gattaaacgg
    3951  ttacgctatc gtcggtgtga tagtgacttg attagaatta agattcctcg
    4001  gtactctagt aagactcgta gttgtttacc agggtgctat tacttgtatt
    4051  tggacgctaa gtttgtgagt cgcgtgtacg aatacgtggt taataattgt
    4101  gttgtggtga atgctaagac ttttgaatgg acttggaact acatcaagtc
    4151  ctgtaagtcg agagtggtca tcagtgggaa gatcatccat agggacgttc
    4201  ctatcgcatt ggagtatttg gatgggtttt ctgcggttat gctgtccgcg
    4251  ggcgtgaaag gtaggcagaa cgcagaagcg ttttctaggc gtctagcggc
    4301  cttttcagga gacacttctc tttttgaatt ggtgaggttc gccatttcag
    4351  agaagtgtcg cgatttattt gtgggcattc aggaggctgt ggagagatgc
    4401  gtgaaatcat acctcagaaa ctcgtttaat atgagtttcg tagacttgtc
    4451  tgatcctctg ctcaccatca gtgagtactc ggagttagat gttcctattg
    4501  atttaccggg ttttggctgc atagcggagg aggacgaggc taaactcata
    4551  gaagatggag ttaagtcagc tctactgcga aaagcagttc gtgacgaagc
    4601  acaactcatt ctcgaaaggg gcggcacgtc agagatcgtt ccctgtgggg
    4651  atgaggaaag tttaggcggc gacggttctg acagtttact cgggtccggt
    4701  agtgattcac cttctaatgc tagttctggt ggtttgcggg ccggagctgc
    4751  cccttcactg tttagaagtt tgttaaagaa gttgggtggg ggtttttgca
    4801  tggccaaaag gttgttggac ttgttgtgcg agcgattagt tgcttcgtta
    4851  tcgcgcctaa agttcggtac aactcattta acctcattct ttagcgtgtt
    4901  acgtattaag ctttcgcgta atttcttcga cgactcgatt tttgctgctg
    4951  tttgggacac agtaatgaac ttgattagaa tcgtcaatgg ggtgaccaag
    5001  acgaagttgg agtgttttcg caacgtactt cggttaattc ctaagctgtg
    5051  ttctggttgt aaggacctcg cgaaagactt tgcggacatg tgtaggttag
    5101  ttttcctgct ttctacggag tttttcagta aaagctacgc taaactatgt
    5151  cggtttagtt tggaaatatt cgatatcgga ctcattgaaa tttcagcccg
    5201  taatatggga ctagagactt gtgtttcgat ggcttcggct atttttgatg
    5251  ttatacttac ttatcctctg ggaagtgtta gctttcctat cgtttgcgcg
    5301  agggttttcg gcgccctcgc tatggaagta ggatcgaact attgttttaa
    5351  gaaaactttc ggcaaacctg aaattttagg agaggatgct ttccgtagaa
    5401  cggtaagtat ggtgttgagc gctaaggctt tcgacaaact ttcggtcgac
    5451  ggtaagggtt tagttaggtg ttccggtgtt atacctggaa tactgaggat
    5501  agtgttttcg tctctgtttt ccgatgccga cgcatgggta ggttatagta
    5551  aacacgaagt ttcctcgctt cccatagtta cgtatagcac gaaaaggttg
    5601  tctttcgtgt tggagcagac taaggaagcg tgcgtcgctt tcatagtcga
    5651  ttcgtctaag aagattttag catctttgac ctcagagatt cacgagtctt
    5701  tccaaaactc ggaattaact agtggtgcta aatccttgta cggacatgtg
    5751  agttctatac tctcagcgtc caatggtgta gttaacaagg cagggaacgc
    5801  cgttgcagcg gttaaagcgg cggggagtgg tcttagcaaa cgtgtgaggc
    5851  gcattcggcc ttcctttcgc cttgctcggt gtgttaatga acagaccagc
    5901  gaatactact ctgctagtga cgagtctgag ttggatgagt cgttgcttag
    5951  tgacacaccc ggtcttcgtg gtaacgggaa gtgttgcgat ttgtttcgtg
    6001  tcgtttctgg acgtgtctca gtatgttgta ggcacgctgt ggaggccttg
    6051  aggcgtttag ccctacacgt cggtgactac ttgtactcgt gcattatgga
    6101  ctcttttgtg aggttgttcg taagaaccaa cactgcagtc gggaagtgtg
    6151  aatccttcgc tgtcgattgt gccactaaga tttctgattt ggtagtcgga
    6201  tatattgctt ggcgcaatct tcattccggt gcgtattcga caactccagg
    6251  attatccggc ggcagtagaa attctctttc caggttcttg gacggcggtc
    6301  tcatgtgtgt aattcaaaat tttgttaccg cgtggcagac ggttttcaat
    6351  gagacctttt attcgagctt ggcccatcgg atgaggactg cttcgataaa
    6401  tgtgttgtta gagttcctga agaacctccc ggtttgttta gtttcgatat
    6451  acactttcat agagtgtaga tctaggattt ttcctttgaa ggagtttctc
    6501  tggggctttt gcgtttttgt ttggaacatt gttaaggaac tttccatatg
    6551  catttacgga aatctccccg tttgcgttac gaggttgtgt aatagggcgt
    6601  tccgtcgcag ttccaacgaa ggtgacgtgc gtacgcttca agtgatcacc
    6651  gaagccgaaa accgaatcga gtttttgcga gaagttctcg ccgaaatggc
    6701  acggtatcgt gcttctctcg agatacccgt accggggtcg cctgatagtc
    6751  ctttgtttcc accgacgtac ggtgagattg aggagttagg taacgattcc
    6801  tctgacagtg cccgattgat aggtgtggac aatggttcag attcagtgtc
    6851  cactgaaggc gaagcggaac tagattcgga tggtgatagc gatgattcaa
    6901  tacctttgga tcgcgacttt gagcaaatcg gaggtcttgg cgggagcggt
    6951  aacgttgacg tctttcgttt agggctgagg ttcgtgtgga gaatgttgcg
    7001  taatttgttt aacttaagag ccgttaaatt ttcctatggg ttagctcttc
    7051  agtgtatatt taacggcggt tcaatgggcc agtttacgtc gcgactgtta
    7101  ttcagtttcg gcaactgctt accgtttgag ttctttagac acgtttgcag
    7151  tgtgaggtgg ctgtcaaaga gcttagcact acgtgttcgt aacgctagtg
    7201  tttgtgacga ggaaacggtt gaatatttct tcagtttttc gcgatttttg
    7251  tacgattcgc gttacttatc ggacgtgttt tcggtgttgg agagggtcga
    7301  tttttactta agttatctac tctcgttgcc gaagaggtgt cttacgcgta
    7351  accgtagtgt ccgagtttgc gctagagctc cagttcgtgt gattagggac
    7401  gtgggagttg tagaagacgg caagaagtct ttaaccgaag tgttgaactc
    7451  tttggactca ttgaaagtgt ccgaccgtaa agggaagtca gcacttattg
    7501  aaagtgataa ttccgattcc gaaagcggtc attcgttcgg ttccatttca
    7551  ttcggatcgg ttaatgagga agttttagaa gcagtgaacg gtggtgttgt
    7601  atccgaaaaa gctccactga tgaagcatgc agctgcacta agcaggttgg
    7651  agccagatct tagcggtaat aaggatcttc ctattgtcag gagaagtttt
    7701  acccgcggtg aatcttcagg tacgaaaccg gcaggaagct tgtgcgtgta
    7751  cttaacgacg ttgaattctt cattcggttc ggtgcctgac ctgtatcccg
    7801  tcgcacgtga cataacgtac aagaagatga ccaacgccat gcgcgagttt
    7851  tattactcgc aaaaggtaac gttgtacgaa cttcatggaa aattgagctc
    7901  gtactgggat gaattaaaga cggtaggttt tgataggaag ttggcgaaga
    7951  tggatttaga cgatgacgtt agtgtcgtcg attttaactt gaaggtaata
    8001  gtggggaggc atggtacccg tcctttcaga aatactgtga actctcacga
    8051  gttcatgttt tgtgatgacg gattggtgct ttgcccgggt ccgaaaaaac
    8101  gtgactttgc tctgatctct agtcaaacgc aatttgttgc tgcgaactca
    8151  ttcctgcgtg ccgtggacgg taaagatttg acgttcacta attcggagca
    8201  tagtctcata gtttatgagg ctcctcccgg tggtggaaag acgcattctt
    8251  tggtaaagta tttcgccgat tattgtacca aagtgtcttg cttggtggtg
    8301  accgctaaca aaaattcgca agcggagatt tctcaaagaa tctctagaga
    8351  gttaatggat agaaagatgc ttgctaaaca cgttgttaaa accgccggta
    8401  gagtgttcac tgtggactct tatctgatga accatattcg actcaagact
    8451  gatttgttgt ttgttgacga gtgttttatg gttcatgctg gagcaatcgg
    8501  agcagttgtt gagttcactt catgtaaggc tgtggttttc ttcggtgata
    8551  gtagacaaat tcattatatt caccggaacg attttggtgt ttcattgttg
    8601  catgacatag acgcatttat agaaccacag caccgcattt acggtgaggt
    8651  gtcctacagg tgtccttggg acatctgtga gtggttgtct aaattctatc
    8701  cgagacatgt ggccactgct aacactggta gtatcgggaa atcgagtgtg
    8751  tctatagaga taattaatgg ctgtgacgat gttccttacg atagtagcgc
    8801  gaagtacatc gtttacacac aagcagaaaa gaacgaactg caaaagcacc
    8851  ttggtcgttt aaccgtaggc cgaactaaag cggtgcctat tgtgaacaca
    8901  gtgcatgaag ttcaaggtga aacatataag aaggttcgtt tggtaagatg
    8951  caaataccaa gaggacactc ctttctgttc agataatcat gttgttgtgg
    9001  ctttaaccag gcacgtcgac tccttaactt attccgtttt gaatagcagg
    9051  agatacgaca agaccgcttc cagtatagat gaagcgaggg agatttttga
    9101  caaatttcgt tcgacgaacc attctcacgg ttcttcgacg ttggaatggt
    9151  accttgagaa ataccctact gaatataagg gtagtaaagc atcttcggcg
    9201  ccgttaagtt gtattaacga gtttcttaac gaggtcgttg tcggttcttc
    9251  agttgtgcag ttgggagata cttcagaaga attaagttct cgtccttttg
    9301  agtctggatg tgacaatatt accgtaaggg acactgcacc ccctgattca
    9351  ggtaatctac acgaaccggc tcgcgttcgg cgtggtaagg tcgcaagcaa
    9401  ttccgccaag aaaagcgtcc ctacaagaaa atcttctgtc gtacgaaagt
    9451  cgtaattaca actttataaa gacggagcga tttgtggggc ccgaaaattt
    9501  tggtagagcc atggctgcgg ctgttattga gaggtgtttt aggatggacg
    9551  aagtggccaa gataagaagc gatattattg ctttgactga agccaatatt
    9601  caaaaatggc tcgataaacg tactccgtgt caggtaaaat ctgtgcaggc
    9651  cgaattgaag ttaccgtttg atgtggaaga gcaaatcacc aattacaaac
    9701  taatggttaa gcgtgatgct aaagtaaagc tcgatgattc gagtctgtcc
    9751  aagcaccctg ccgcacagaa tattatgttt cataagaagt ttattaatgc
    9801  tatttattct ccatgcttcg acgaatttaa gaatagggtg ttatcgtcac
    9851  taaacggtaa tatagtgttc tttaccgaaa tgacgaacgc tgggttggcg
    9901  gaagtcatta gaaggattat aggtgatgac gataatcttt ttgttgggga
    9951  agtggatttc agtaagttcg ataagtctca agatttgttt gtcaaggagt
   10001  acgagcgtgc gttatactct gagttcggat ttgatgacga acttctcgat
   10051  gtgtggatgg aaggcgagta ccgcgctagg gctaccacgt tagacggtca
   10101  actgagtttt tcggtcgacg gtcaacgtcg ttcgggaggt tcgaacacat
   10151  ggattgggaa ctctttggtt accctgggta tcctatcctt gtattatgac
   10201  gtctcaaagt tcgagctact gcttatatct ggtgacgact ctctgatcta
   10251  ttcaaaagaa aagattagta acttttcttc agaaatttgt ctggagacag
   10301  gttttgaaac caagtttatg tctcctagcg taccatactt ttgttcaaag
   10351  tttgtggttc agacagggaa caaaacgtgt tttgtaccgg acccttacaa
   10401  gttgttggtt aaactggggg ctccccaata caaattgact gatgacgaac
   10451  tcttcgaact gttcacttcc tttaaagaca tcactcagga ctttggtgat
   10501  caggtggtct tagagaaatt gaagttgtta gtagagacta agtacggctt
   10551  tactagcgga actactatgc ccgctctatg tgctatacat tgtgtacggt
   10601  ctaattattt gtcttttgaa aggttgtttc cttttattag aggttggtac
   10651  gttgtcgacg ctttgaagct tagacaactg aggaaattcg ccaatttgat
   10701  ctgtgaacgt gtggtttacg ataatcgcgt gggttatttt tcgtactttg
   10751  acaatccgtt tgctaaaccc gacgctagcg atggtcaagc ggatgactta
   10801  gcgacaggtt gatagtttgt tcagttctcg ctgagagcta acacgggtag
   10851  tcgagtcgag atgtttgcct tcgcgagcga aaaccaagac atattagaag
   10901  aaaagatttt tcgccgtaga acctgccatc gtaagtattt ggatgacgtg
   10951  gttagggact ttaccattga tattggttat gatactgtcg atcgtgatcc
   11001  tacagtattg gccgattatt tctcgttgta tttctttttg cttaacaatg
   11051  ataacattgg gcctttagca gcttcgatta tagtaagccc gccagtaaac
   11101  gggactcata aaattcgagc gcacgtcgat aatcaaccga atcgtgaagg
   11151  aaacgttact tacgttaaaa ctgtcgataa gagtcgtttt gtgattcgca
   11201  taaaagcgat gccagcttct atgagaggct actactcctt tcgggcgttt
   11251  gttagtggtg acgtcgctag cgaacgtagt gagtttatat gcagttttgt
   11301  tggtagtagg tttctttgtt gttgcacaca aacgatatcc gaaaatttga
   11351  acaatgtttg ttcgtcttcc ttcttcttta gagctgtctc ggaaaccgct
   11401  actaatgagt tttcggttgt gactgatgat gtagaagacg ttaagtacgt
   11451  aagaaagcga gtcgagggtt tttcacactg cgctgacccg tatccaccta
   11501  ggtgttatcg taatgctaat ttaggtgatt cttcaggggt ccaaagtcgc
   11551  acgattgaag aggaaggtta taggacggac actgcaggta acgtcgcggt
   11601  taccgtcccg aacactccac tcgttaatgc cgtctctccg tatgtcgcgg
   11651  agtacaacga aaatacgcgt tcgcgtatct cgttaatacg gcgagtctgc
   11701  tgttacgccg tttgtgtttt agtggtttct cttcttataa tgagcggttt
   11751  gttaagcatc atattcatat gacttggtgt agtaacttat agggcatggt
   11801  tagctaaaac tcaccgtttg actctgttta aacggggttc aatggactgt
   11851  gtaattcaag gatttttgac ttttctagtt ggtatagctg tgttttcggc
   11901  ttttgccgga ctaattatca ttgttataac gatttatcgg tgtacgacta
   11951  agcccgttag aaacgcctct ccttacggca ctcacgtcac tgtttaagcg
   12001  gtatggtgct tctgggttta gactttggta ccacgttttc gacggtggct
   12051  atggctacgt cttctgagtt agtaatactt aaacaatcca attcgtcgta
   12101  catacctacg tgtttgtttc tgcatgcaga tcctaacagc gtgtcttatg
   12151  gttacgatgc ggagtactta gcggcttcgg gggaacctgg ctcgttttac
   12201  aaagatttga aacggtgggt cggttgtact gagaagaact accaaagtta
   12251  tttgcacaag ttatcacctt cctataaggt gatagtaaaa gagttcggaa
   12301  ttaagagtat gccggttccg tatttgtcac ctctgaataa tgatcttggg
   12351  ctcagtgtcg ctttgccttc gttaatcgct ttatatacca aatcgatttt
   12401  atcggacgcg gagagagtgt tcaacgtgag ttgcactgga gttatatgtt
   12451  cggtacctgc tggttataac acgttacaac gagcttttac acaacaaagt
   12501  gtgtctttgt cgggttatac ttgcgtgtac attattaatg aaccttccgc
   12551  tgccgcttac tccactttac ctaagttgag ttcggcggat aagtacttgg
   12601  ccgtttacga cttcggcggt gggacctttg acgtttctat agttagtgtt
   12651  aggttaccca cgttcgccgt tagaagttcg ggtggcgata tgaacttagg
   12701  cggtagagac atcgatagaa agttgtctga taaaatatat gagttggctg
   12751  attttttacc gcaaaaagaa ctgaacgttt ccagtttaaa ggaagcttta
   12801  tctcttcaaa cagatccagt caagtatact gtaactcatt acgggatgag
   12851  tgaaaccgta tcaatcgatc aaacaacgtt gagggagata gcttcggtat
   12901  ttataactcg aacgatagac atacttacac aagttaaagc taagtctagt
   12951  atgcccgagt cgcaaagttt gaagctagtg gtagtcggtg gaagctcgta
   13001  cctaccaggg ttgttggata ctttggaaac cgtacctttt gtgtctggga
   13051  tagtaccagt ggaagacgca agaaccgccg ttgctagggg gtgcgcttta
   13101  tatagcgagt gtttggatgg taggtccaag gccttactaa tagattgcat
   13151  tacgcatcac ttgtcggtta cgacatttag tgcagactcg gttgttgttg
   13201  ctgcggccgg aagtccaatt ccttttgaag gagaacgaaa gctcacattg
   13251  cgtaagtgtg ttagtacatc gaattatcaa gcaaggatgt tcgaaggaga
   13301  ttacgaaaaa gttttccgaa acgaacgtat atacgcagct tcggtgtcat
   13351  tgtttacttt aggagttaac tggcgcgtgc ctaacgacgt tgagatgact
   13401  ctcgtgacca aagtggactc aatgggtaaa gtggaattct accttaaagg
   13451  tccatctggt gaactagtta acgtgcaagg tacttcacat tatgattatg
   13501  ttggtatgcc tcatcccact agaaagttgt tgaggcttag cgattacaat
   13551  gtaaactccg ccgctttagt tttagctttg acattgactc gcgaaaaacg
   13601  agaaaaattt cttttgcgaa ctttatttga tactttacta gcggacttgc
   13651  gaaagaccgc aagtttaagc gaatattcta agaaatatcc gattactcga
   13701  aacgacattg atgtcgtctc atcacgtatg gggatcgttg tttcgaaagt
   13751  tttacgggga agcgatttgg aaagagtacc tctctgaatc aactcgaaat
   13801  ttcgatgaga gaaacgtatc gttggaccac actttaagct caggtgtggt
   13851  cgtccgtagg caaaatcttt tgaacgcgcc tcaaggaact ttcgagaatg
   13901  agttagcgct attatacaat tcagtagtaa ttaacgattt tgttgaattg
   13951  actggtatgc cgttgaagtc tttgatgaca ggtgttgagg accgtaaaat
   14001  acctgacgag ttaatatccg ttgacccgca tgaagttgga tgtagattca
   14051  cgttgaatga tgtagaatca tatctaataa gcaggggtga ggattccgct
   14101  gatgtaacgg cggttgagca ctcgtggtgt ttgagcaatt cttgtggtag
   14151  attgttaagt tcgactgaaa tagatactta caaaactatg gtgtttacta
   14201  agacttttaa tagtggtgta tttggggtga ccactaaatt agagacgtat
   14251  ctatcatact gcatatcgtt gtacaagaaa cattgtatga aagacgatga
   14301  ttactttaac cttatattac ctatgtttaa ttgtttgatg aaggtgctgg
   14351  cgtcgcttgg tttgttttac gaaaaatgta ctgacaatcc gctgctgacc
   14401  ggcatgctta tagagttttg cctagaaaat aaggtgtatt actctacttt
   14451  taaagtaaat ttggacaacg ttaggctgtt taagtctaaa gtgttgcctg
   14501  tggtgttaac ggtctgggat atatctgagc ctgatgaccc ggtagacgag
   14551  agaacactgg ttcctttcga ccctacggat ttcgtgcttg atatacccaa
   14601  gctgaatata cacgacacga tggtggtggt gggtaatcaa atcagacatc
   14651  tagagcacgt ggttgagagc gatgctttag acgacttgtc tcaacatgtt
   14701  gacttgaatt tagcagcgga caatcccgat ctacgtgttg atttgcgttg
   14751  ggcagggatg tttgtgtatt acggcatata ccggtgtgct gtacatagag
   14801  tggtagaacg accggcatta tttaatttac cgcggaagtt gttaaatcag
   14851  gacgacggtg agtcatgctt gttacgtatg agttccgttg agaccttatt
   14901  taatttggtg cagaaggtaa ataaggacat aaacattagg cgtcaattca
   14951  tgggacgtca tagtaaagtg gctttgcggt tgtatcgcaa tttaggtttg
   15001  aagtttcctc caatttcctc ggttaggtta ccagctcatc acggctactt
   15051  gtacgtcgac ttttacaaaa gaatacctga taatgctgtt gacgccgacg
   15101  aactggaaag tttacgtcaa ttacgttcat ccgtggacgt tatgtgtaag
   15151  gacagagtgt caatcacgcc tccaccgttt aatcgacata gaagaggttc
   15201  ttctagaata cttagaggtc gaggcgcacg cggtgcgagc tcgcgttata
   15251  tgagcagaga cgtggcaaca tccggtttta atttaccctt tcatcatggc
   15301  gggttacacg atgcttccca aaactgatga caaagaaatg gacccggtga
   15351  gtgccgctgt gcccggtaaa tacccggacg ttatcgaaaa atttgtgacc
   15401  aataggtcgg tagatgcgtt aatagaaggt gttattagca agttggatac
   15451  taattcaata tacgaagatt ccactgaaaa atttactggt gagcaattga
   15501  agtacgtcat ggttactatg gacactttct tactagaaaa ttacaaaacg
   15551  aaaacggagg atctgctggt tcacttggct atgattcaaa agaggttgtg
   15601  cactatatct acgagtacta aaaccaaatt tcgtgataaa ggttgtatca
   15651  gttacgtgca agggggttta cgatataagt taatggataa agtagttttt
   15701  ccctttatta tatctaagtt tactgacagg gagactccca acgctctacg
   15751  taagtatgct tgtgcttttg aggagttaca cttgtgtatg gctaggctga
   15801  gacccgactt atacgaaaac aaaaggacga ccaaagctgg gactccgcat
   15851  ttaaaaggct acttatcagc tgattttctt acgggttccc tcccaggata
   15901  ctccgaacat gaacgaggta tcatccttcg agcgtctgaa tctatgttag
   15951  ctagacgtca aggttacgag gaggcaaccg agcttcttaa cttacgcgat
   16001  ttgggaaagt atttgtagtt agtttgcgga cggtggtatt acgccatccc
   16051  atgagcactg ctttaagggt cgttaattga cgactcttga tatttactaa
   16101  gtttgagtta tggacgacga gacaaagaaa ttgaagaaca aaaacaagga
   16151  aacgaaagaa ggcgacgatg ttgttgcagc ggagtcttct ttcggttcct
   16201  taaacttaca catcgatccg actctgatag cgatgaacga tgtgcgtcag
   16251  ttaagtaccc aacagaacgc cgctttgaac agagatttgt tccttacttt
   16301  gaaagggaaa tatcctaatt tgtctgataa agataaggac tttcacatag
   16351  ctatgatgtt gtatcgttta gcggttaaga gttcatcgtt gcaaagtgat
   16401  gacgacacca cgggcataac gtacactcgg gagggcgtcg aagtggattt
   16451  gtctgacaaa ctttggactg atgtcgtgtt taattctaag ggtatcggta
   16501  accgtactaa cgcccttcga gtctggggta gaagtaacga tgccctttat
   16551  ttagcgtttt gtagacagaa tcgcaatttg agttatggcg gacgtccgct
   16601  agatgcaggg attccagccg ggtatcatta cctgtgcgca gatttcttga
   16651  ccggagctgg cttgactgac ttggaatgtg ctgtgtacgt acaagctaaa
   16701  gaacaattgt tgaagaagcg aggggctgat gaagtcgtag ttactaatgt
   16751  caggcagctt gggaaattta acacacgttg atctattgcg ttctgaatct
   16801  cgatttctat cgggatggtg gagttttgtc gtgaacgtgg gtgatataat
   16851  cgttcggttt gcgttacatg ttcctagtga agatatgctg aatagctttt
   16901  cagctatatc gaattgtacg atcatagcag acggtagtgc tttactaaaa
   16951  gacaacactg tggttgaccg tttagagagc atgaatcctt tggcttattt
   17001  gttaaaatta gcgaaaacga ctactactat ttgctttact atgtctaata
   17051  aggttctttt tggtactact aaatctgaac cgcttagttg tttagctatc
   17101  acgtcggatc gagttttatt caaagttatt atgggtacta acgttgatga
   17151  ttctcgatgt ggctgcagta tttggtttta caacaatggg acgtttctaa
   17201  acgggttgac ccgttgtaac aatctcgtcg ctttgtttag cgcgacttag
   17251  acacgaagtg accgttcggg tttaattgct gcaatgggta ttcgacgcgt
   17301  gtggttaaag attatggctg taattacggt attgtggtat ggtaaagaac
   17351  cttccattag cgaaggttac aatgctctta tgaatgatga ctttaagttc
   17401  atcgatacgc acttttcaaa cgcttcttat gctaagaaat gttacgagtt
   17451  ggctaacttc gacttagact ttctacgcat cgtcatcatt cccttgagcg
   17501  gtggtgcggt gaatgaatcg cgtgctgatc gcgctaacgt ttcagagatt
   17551  gtcgaatcgc atatgagcga ccgagacaga atgaaaatct tgttgcgtaa
   17601  taagcggatc cagattcctt cgctcttacc ttgcgataac tagagtctac
   17651  tcagtagtac gtctactagt ataacgtatt aaacacttta gtgaggagtt
   17701  ttgtttaaac caaacaatat gcgagcttac tttagtgtta acgattacat
   17751  aagccttttg gctaaggtcg gcgcagttgt ggaacgtttg tgcgatccca
   17801  gcgtaactct cacggaagtg atggacgaaa ttaatgattt taactcgttt
   17851  ctcgctttgg tacactctat gaagtcggac atgaacggcg atcatcagga
   17901  tggtcaccat gagatgggcg aacacaagtc tcgattgttg tgcaatatag
   17951  aggcgaaact gcgaatactt ctcgacatca taagacgtcg gtttactcgc
   18001  gacaagctgc tctgtaccag tgcaacagat gtcatgggct tcttcgttat
   18051  gaggtacatg agttctagtc acaccagttt tgagtccgta atgcgaacgg
   18101  agctgaaatt agtggttaaa gcggtactgt cggatttatc ccgcgcgcat
   18151  aaactagatt ttagcgagcg agcctttgcg gcttacggta tccttttaca
   18201  aaagggtact gtagcgaccg tttgcggtca gtttgacatt aatttagttt
   18251  ctccttcatg cgtgtaggtc aatacgcttc tcagaacgtg tggttgtatt
   18301  aactaacttt aattcgaaca aatttattgt taaaagtctg tgagttacga
   18351  tggacgatac tagcggacaa acttttattt ctgtgaacct ttctgacgaa
   18401  agcaacacag ctagtactga aatcaaaacc gtaagttcgg aagcggatcg
   18451  cttggaattt ttacggaaaa tgaatccctt cattatcgac gctttgatac
   18501  ggaaaaatag ttatcaaggc gctcgctttc gcgcgagaat aataggagtg
   18551  tgcgtggatt gtggtagaaa acacgataag gcatcgagaa ctgaacgtaa
   18601  gtgtaaggtc aacaatacgc agtctcagaa cgaggtggcg catatgttaa
   18651  tgcacgatcc cgtaaaatat ttaaataaaa gaaaagctag agccttttct
   18701  aacgcagaga tgtttgcgat cgatttggtt atgtacacca aagaaaggca
   18751  attagcggtt gatttggccg ctgaaaggga gaagacgaga ttggctcgta
   18801  gacacccgat gcgttctccg gaagagactc cggaacatta taaattcggt
   18851  atgactgcca aggcaatgtt accggacatc aacgctgtag acgttggcga
   18901  taacgaagac acctcgtcgg agtacccagt aagtctgagt gtttccggcg
   18951  gagttctccg tgaacaccac ttcatctgat tgaagtggac ggaataagtt
   19001  cctcgcggaa ctatatgtcg ggtcggtaaa aacccttatg atggtgatat
   19051  atcactagac aataaccgga tgggtaaagt ctttaaaatg atcgagggga
   19101  aaattaacca tatcctctcg ttggtctaag ctcccacaga gtggtagtgg
   19151  tctcaagtga ggcttaacgt atgcgtgaac caaagaagtt ctccttagag
   19201  tgtgtgttgt ttacccaaca cactgtccct atggggggcc aacataggtc
   19251  ca