Sequence of DPV Arabis mosaic virus large satellite RNA

Arabis mosaic virus isolate P116 satellite-encoded protein mRNA, complete cds.

ACC No: DQ187318

Dated: 2006-02-18 | Length: 1104 | CRC: 1853011431

                
ID   DQ187318   standard; mRNA; VRL; 1104 BP.
XX
AC   DQ187318;
XX
SV   DQ187318.1
XX
DT   18-FEB-2006 (Rel. 86, Created)
DT   18-FEB-2006 (Rel. 86, Last updated, Version 1)
XX
DE   Arabis mosaic virus isolate P116 satellite-encoded protein mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Arabis mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Nepovirus; Subgroup A.
XX
RN   [1]
RP   1-1104
RA   Wetzel T., Bassler A., Amren M.A.W., Krczal G.;
RT   "A RT/PCR-partial restriction enzymatic mapping (PREM) method for the
RT   molecular characterisation of the large satellite RNAs of Arabis mosaic
RT   virus isolates";
RL   J. Virol. Methods 132(1-2):97-103(2006).
XX
RN   [2]
RP   1-1104
RA   Wetzel T., Bassler A., Wahab A.M.A.B., Krczal G.;
RT   ;
RL   Submitted (30-AUG-2005) to the EMBL/GenBank/DDBJ databases.
RL   AlPlanta - Institute for Plant Research, RLP Agroscience GmbH, Breitenweg
RL   71, Neustadt an der Weinstrasse 67435, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1104
FT                   /db_xref="taxon:12271"
FT                   /mol_type="mRNA"
FT                   /organism="Arabis mosaic virus"
FT                   /isolate="P116"
FT                   /specific_host="grapevine 'Zirock'"
FT   CDS             15. .1031
FT                   /codon_start=1
FT                   /product="satellite-encoded protein"
FT                   /protein_id="ABB03715.1"
FT                   /translation="MDSRITANPSLHSPRVSVEILVPTKYAKLFTLKQLARMLALSCRH
FT                   RARQAVNSVSKRTSRDRNGSKTMGQGPPAVGPQVSKGHKQQFDGGASLAPVKSKRAARR
FT                   EKRRAAAKKAKAKAETTLVKKGGPSVHAPVRPKQATYLSSLLSNPLGAKPKMGTLSKSP
FT                   QTKNAPRVNEGGFTLTSISPAECRAESGRRFHPLTGTCLGNLGFCTRSREGCGSCAACE
FT                   ARSAHRGFDRSFDVIGTSRVLRVDSMKAETSDDMASPSASEPVGFWAPAEKQAPREGRP
FT                   IKRCDVVTLARVVPVMRMLRKVDPTLVDNRLLWEAARQTVFPQRKCAYPVGCFGDHW"
XX
SQ   Sequence 1104 BP; 239 A; 284 C; 321 G; 260 T; 0 other;

dq187318 Length: 1104  18-FEB-2006  Type: N  Check: 2550  ..

       1  tatgaaaaat ttctatggat tctcgtatta cggcgaatcc atctttgcac
      51  tctcccaggg tctccgttga gatcctggtc cctaccaagt atgcgaagtt
     101  gtttaccctt aagcaactcg ctcgcatgct tgcattgtcg tgtaggcacc
     151  gtgcacggca agccgttaat tcggtaagca aacggacctc ccgagaccga
     201  aatgggagta aaacaatggg tcagggacct cctgctgtgg gcccgcaagt
     251  gtcgaaggga cacaaacagc agtttgatgg aggggctagc ctagccccag
     301  tgaagtcaaa gcgtgcagcg cgtcgtgaaa agcgccgcgc tgcagctaaa
     351  aaggcgaaag ccaaggccga gaccacactc gtaaaaaagg gtgggcctag
     401  tgtccacgcc ccagtgaggc cgaagcaggc gacttatttg tctagcttgc
     451  tttcgaatcc acttggggca aaacccaaaa tggggaccct gagcaagtcc
     501  ccccaaacaa aaaatgctcc cagggtcaac gagggtggtt tcaccctcac
     551  ttctatctca ccggctgagt gtcgggcgga gtccgggcgg aggtttcacc
     601  ccttaactgg tacctgtttg ggtaacctgg ggttctgcac gcgctcccga
     651  gagggttgtg gctcttgcgc tgcctgtgaa gccaggtcag cgcatcgcgg
     701  tttcgaccgg agttttgacg tgattggcac ttctcgtgtc cttcgcgtcg
     751  attcaatgaa ggcagaaacc tctgatgata tggccagtcc tagtgcttca
     801  gagcctgtag ggttctgggc tcctgctgaa aagcaggccc cccgggaggg
     851  acgccccata aaaaggtgcg atgtggtgac actcgcacgc gtggttccgg
     901  ttatgcggat gctgcgtaag gttgatccca ctcttgtgga caaccggcta
     951  ttatgggagg ctgctcgtca gacagtcttt cctcagcgca agtgcgcgta
    1001  tccagttggt tgctttggtg accattggta gggaagattg ctgtgggaca
    1051  tcgtttgttt atagtctggc gtaagctggg attttggttg ctcattagca
    1101  actc