Sequence of DPV Operophtera brumata idnoreovirus

Operophtera brumata reovirus segment 1, complete sequence.

ACC No: DQ192235

Dated: 2005-10-29 | Length: 4170 | CRC: -2089594181

                !!NA_SEQUENCE 1.0
ID   DQ192235   standard; genomic RNA; VRL; 4170 BP.
XX
AC   DQ192235;
XX
SV   DQ192235.1
XX
DT   29-OCT-2005 (Rel. 85, Created)
DT   29-OCT-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Operophtera brumata reovirus segment 1, complete sequence.
XX
KW   .
XX
OS   Operophtera brumata reovirus
OC   Viruses; dsRNA viruses; Reoviridae; unclassified Reoviridae.
XX
RN   [1]
RP   1-4170
RA   Graham R.I., Rao S., Possee R.D., Sait S.M., Mertens P.P.C., Hails R.S.;
RT   "Detection and characterization of three novel species of reovirus
RT   (Reoviridae), isolated from geographically separate populations of the
RT   winter moth Operophtera brumata (Lepidoptera: Geometridae) on Orkney";
RL   Unpublished.
XX
RN   [2]
RP   1-4170
RA   Graham R.I., Rao S., Possee R.D., Sait S.M., Mertens P.P.C., Hails R.S.;
RT   ;
RL   Submitted (04-SEP-2005) to the EMBL/GenBank/DDBJ databases.
RL   Molecular Biology, Institute for Animal Health, Ash Road, Pirbright,
RL   Woking, Surrey GU24 0NF, United Kingdom
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4170
FT                   /db_xref="taxon:352248"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Operophtera brumata reovirus"
FT                   /segment="1"
FT   CDS             33. .4109
FT                   /codon_start=1
FT                   /note="RdRp"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="ABB17205.1"
FT                   /translation="MDSTRQVSLTLQQITKRLHLLISTQHNLTSSKQDTLTVQTNSIAF
FT                   KAWYDTLQRRTDILFNKTELTLEDITGFDTSSQVGIYHTSLILLLLQEIKFRVTLSSSA
FT                   ESDLERIVSPPHYEFGTSSFRVNELDQHIEAASVRYVLNYDAYKIVRDAEAIQLVSKKV
FT                   RKVVSDELLEDKIVQYSSGDVNLYREADVMHGLVIKYVSQPRLLPIPKLIQMIIETSNF
FT                   PERGFELHENPVLYIISRLLSKYIDFPFTEKSGEMVYHHSVSMTTPHLIYSLSQLWIQY
FT                   ILNNVTRSELYMMVECHVMLSVKSFDEFVLEFKDLRINSSKILTEMVKQAFIPIYGSVA
FT                   PAGIMLKEDFSDIWRDGEREQFGTDFLQLCPMPLQKYLTDRRIIVNSQFTLGKIFEDDN
FT                   EARRTHLIITLSTQHGLFIKNPVIFTIDKSVHPRPSLGVGYDIKEYMVNPSDQTDSYPL
FT                   TLLWKSSVTQSIRDELLGMIRPYGDRIRSMDLFQEFIRCLTNNSGGIPYEPTPEETKTI
FT                   PAGVLRALGRKRLMFFLLNPTVFSVYSAWRKAVETPTSSGERKQVDRRGRVIQMVSNPA
FT                   QIGAFLLFLIADTIGSQEPEFSSKKNSGTINDMMFQLSESGVNGVVYECADVKGMDAAT
FT                   TKTLCALTGELVVDLFREHNGMTYFWAQSKDWNVVDSNGTSRRERIAAPIEVFRACEKF
FT                   ADTTPFRLHEPETFGHVTTSPDSFPSGKFSTNAQHSFINAGAVRSWGKSFNRQMLQSKD
FT                   SNERLTQPVRVTSLISGDDLTIKVIYGNETVKALLAFSDGLQRHYANIGLSLESVLSKY
FT                   SATFLQMTAVLGKPWPKADRISIVTSEHGDAQRVEFREAMAEVIDVLRELSGRSGIPSN
FT                   WVPIALVMGNMLRRLRVVISDTFNPVTEEHLQDDRILKRGNSIYIKIPFITLFIKEGLG
FT                   LPFLATNFLNRVERQLSYAPRGSLSDWHLRRILLKRDPFEYITSNGSQRIYDFYAHYAQ
FT                   ELHEKRLMSDISAFEDAERRIIAEVYGTPSDWYDGALADKLDLDLAVYIAKFDPSTRVK
FT                   QARRRAIPASERDRWTRNLASQLNFQAITKSALAHMTLKELRYNVPEEIAFHHSPAERI
FT                   NQLLESVQGGYEEFMMLRRESLLYRLRYKPGVRWIGPDSIESLLLFNPVILDSEYELHR
FT                   DVVLDRKCKYMPSSTSDFDRTFGAIQIWDTTSLKIFKVFSGYYGYRPGPFKEYNHEALV
FT                   KFAAQVYHTNPTHLPYVWHLANIQGRHRQTLSRMIKHMAVTLGSSWGSTVHTRQLFEIG
FT                   KDPRAIIRCFELPSRLHQRAEDTAALVARDLHLAYGSYGLNQVMIQLHPLFIRQTDGTR
FT                   ERNTLLRMLTKKVIE"
XX
SQ   Sequence 4170 BP; 1218 A; 772 C; 928 G; 1252 T; 0 other;

DQ192235  Length: 4170  November 1, 2005 08:47  Type: N  Check: 6373  ..

       1  aaataaaacc cctccacaat agaaccagac ccatggactc aacgcgtcaa
      51  gtatccctta cactgcaaca gattacaaaa cgactacact tacttatttc
     101  cacgcaacat aatctgacct cctcaaagca agatacacta acagtacaga
     151  ccaatagtat tgcatttaaa gcatggtatg atacactaca acgaaggaca
     201  gacatattat tcaacaagac ggaactaaca cttgaggata ttactggatt
     251  tgacacatca agtcaggttg gcatctatca cacgagcttg attttattac
     301  tactgcaaga aattaaattt agagttacat tatcatcgtc agctgaaagt
     351  gatctggaac ggattgtatc accaccacat tatgaatttg gaacatcatc
     401  atttagagtt aatgaattgg atcagcatat tgaagcagca tccgtgagat
     451  atgtcttaaa ttacgatgct tataagattg ttcgagatgc tgaggcaatt
     501  caactcgttt caaagaaggt tcgtaaggtt gttagtgatg agttgcttga
     551  ggataagatt gttcagtatt cttcaggaga tgtcaaccta tatcgtgagg
     601  cggacgttat gcatggttta gtcattaagt atgtttccca gccacgtcta
     651  ttaccaattc caaagttaat tcaaatgatc attgaaactt ccaattttcc
     701  agaacgcggc tttgaacttc acgagaatcc ggtattatac ataatttcac
     751  gtttgttgag caaatatatt gactttccat tcacggaaaa gtcgggtgag
     801  atggtttatc atcattcggt tagtatgaca acgccacatt taatttactc
     851  gctttctcag ctttggattc agtatatatt aaacaatgtt acgagaagtg
     901  aattatacat gatggtcgaa tgtcatgtta tgttgagcgt taaatccttt
     951  gatgagtttg ttctcgagtt taaagattta cgaattaatt caagtaaaat
    1001  tttaactgaa atggttaagc aagcattcat tccaatttat ggatctgtcg
    1051  cgccagcggg cattatgctg aaagaggact ttagtgatat ttggagagat
    1101  ggtgagcgtg aacagtttgg aacggatttc cttcaattat gtccaatgcc
    1151  acttcagaag tatcttacgg atcggcgcat tattgtaaac agccaattta
    1201  cccttggaaa gatatttgaa gatgacaatg aggcgagacg cacacatctt
    1251  attattaccc tttcgactca acatggatta tttatcaaga atccagtaat
    1301  atttacaatt gataaatctg ttcatccacg accatccctt ggcgttggat
    1351  atgatattaa agagtatatg gtcaacccgt cagatcagac tgattcttat
    1401  cctttgacat tactttggaa aagctcagtg acgcaatcaa ttcgtgatga
    1451  gctcttaggg atgattagac cgtatggcga tcggattcgt agcatggatt
    1501  tatttcaaga gtttattcgc tgtttaacaa ataattcagg tggtattcct
    1551  tatgaaccaa ctccagaaga aacgaagacg attccagctg gtgtacttag
    1601  agcccttggg agaaaacggt taatgttttt cttgctcaat ccaacagtat
    1651  tttcagtata tagcgcatgg cgtaaagcag ttgagacacc aacatcgtca
    1701  ggtgagcgga aacaagtcga tcgtcggggc agagttattc agatggtttc
    1751  aaacccagct caaatcggtg ctttcctatt attcctgatt gcagatacca
    1801  ttggaagtca agaaccagag ttttcttcga aaaagaattc aggcaccatc
    1851  aacgatatga tgtttcaatt atcagaaagt ggcgttaatg gtgttgtata
    1901  cgagtgtgct gatgtgaagg gcatggatgc tgcaactacg aaaactcttt
    1951  gtgcgttaac aggtgagctt gtggtcgatc ttttccgaga acacaatgga
    2001  atgacatatt tctgggctca aagtaaggat tggaacgtcg tcgattcaaa
    2051  tggaacaagt cgtcgtgagc ggattgcagc cccaattgag gtttttcgcg
    2101  cgtgtgagaa gtttgctgat acaactccct ttagactcca cgaaccagaa
    2151  acttttggac atgttacaac ttcaccagat tcgtttccat ctggaaaatt
    2201  ttcaacgaat gcgcaacata gctttatcaa cgctggtgct gttagaagct
    2251  gggggaaatc atttaaccgt caaatgcttc agtctaagga ttcgaatgaa
    2301  cgattgactc aacctgtacg agtcacttca ttaattagtg gggatgattt
    2351  aactattaaa gttatttatg gaaatgagac ggttaaagca cttttagctt
    2401  ttagtgacgg tttacaacga cattatgcta atattggatt gtcgcttgaa
    2451  agtgtattgt caaagtattc agcaaccttt ctacagatga ctgcggtact
    2501  gggaaagcct tggcctaaag cagatcggat ctcgattgtc acatctgaac
    2551  atggtgacgc tcaacgagtc gagtttcgtg aagcgatggc tgaggttatt
    2601  gatgtacttc gagagttgtc aggacgttca ggtattcctt caaattgggt
    2651  tcctatagct ttagtaatgg gtaatatgtt gcgccgatta cgcgtagtta
    2701  tctccgatac tttcaaccca gttacggagg aacatttaca agatgatcgt
    2751  atattgaagc gtggtaattc gatttacata aagattccat tcattacctt
    2801  gtttatcaag gaagggctag gattaccatt tctggcgacg aattttctga
    2851  atagagttga aaggcagttg agttacgcac cacgaggatc actcagtgac
    2901  tggcatcttc gaagaattct attgaagcgt gatccgtttg aatatattac
    2951  atctaatggg agtcagagga tttatgactt ctacgcacac tatgctcagg
    3001  agcttcacga aaaacggtta atgtcagaca tttcagcttt cgaggacgca
    3051  gagagaagaa tcattgctga ggtttatgga acgccaagtg actggtatga
    3101  tggtgcgttg gctgacaaac ttgatttgga tctcgctgta tatattgcaa
    3151  agtttgatcc aagtacgcgt gttaaacagg caaggcgtcg tgccattcca
    3201  gcatctgaga gagataggtg gacgcgtaat ttagcgagtc aactgaattt
    3251  tcaggcaatt accaagtcgg cactcgctca catgacatta aaggagttgc
    3301  gttataatgt accagaagag attgcctttc atcattcacc tgctgagaga
    3351  ataaatcagt tacttgagag tgttcaaggt ggttatgagg agtttatgat
    3401  gctacggcgg gagtcgttgt tgtatcgact gcgttataag ccgggagtac
    3451  gttggattgg cccggattcg attgagtcgt tgttattgtt caacccagtt
    3501  atccttgact cggaatatga gttacatagg gacgttgttc tagatagaaa
    3551  gtgtaagtac atgccatctt caacttccga ctttgatcga acatttggtg
    3601  ctatccagat ttgggataca acttctttga aaattttcaa ggtgtttagt
    3651  gggtactatg gttatcgacc aggaccattt aaggagtata atcatgaggc
    3701  tttagttaag tttgcggctc aagtttatca tacaaatcca acacatcttc
    3751  catatgtatg gcatctcgcg aacattcaag ggaggcatcg tcaaacgttg
    3801  agtagaatga taaagcatat ggcagtaact ctcggatcga gttggggatc
    3851  gacagtacat acacgtcagt tgtttgaaat cggtaaggat ccgcgagcga
    3901  tcattaggtg ttttgagtta ccatctcgac ttcatcaacg agctgaggat
    3951  accgccgctc tcgttgctcg tgatttacat ttagcttacg gaagttacgg
    4001  tttgaaccaa gtaatgattc aactgcatcc actttttatt cgacaaacgg
    4051  atggtactag ggagcgtaac acattactac gtatgcttac caagaaggtc
    4101  atcgaatgat agtttgcttg gagaacgatc tcgttgacta ccggtgtgtt
    4151  ctatggggcc cgatgaggtt