Sequence of DPV Operophtera brumata idnoreovirus

Operophtera brumata reovirus segment 2, complete sequence.

ACC No: DQ192236

Dated: 2005-10-29 | Length: 3780 | CRC: 919270611

                !!NA_SEQUENCE 1.0
ID   DQ192236   standard; genomic RNA; VRL; 3780 BP.
XX
AC   DQ192236;
XX
SV   DQ192236.1
XX
DT   29-OCT-2005 (Rel. 85, Created)
DT   29-OCT-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Operophtera brumata reovirus segment 2, complete sequence.
XX
KW   .
XX
OS   Operophtera brumata reovirus
OC   Viruses; dsRNA viruses; Reoviridae; unclassified Reoviridae.
XX
RN   [1]
RP   1-3780
RA   Graham R.I., Rao S., Possee R.D., Sait S.M., Mertens P.P.C., Hails R.S.;
RT   "Detection and characterization of three novel species of reovirus
RT   (Reoviridae), isolated from geographically separate populations of the
RT   winter moth Operophtera brumata (Lepidoptera: Geometridae) on Orkney";
RL   Unpublished.
XX
RN   [2]
RP   1-3780
RA   Graham R.I., Rao S., Possee R.D., Sait S.M., Mertens P.P.C., Hails R.S.;
RT   ;
RL   Submitted (04-SEP-2005) to the EMBL/GenBank/DDBJ databases.
RL   Molecular Biology, Institute for Animal Health, Ash Road, Pirbright,
RL   Woking, Surrey GU24 0NF, United Kingdom
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3780
FT                   /db_xref="taxon:352248"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Operophtera brumata reovirus"
FT                   /segment="2"
FT   CDS             78. .3701
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /protein_id="ABB17206.1"
FT                   /translation="METQQKTKKTKKVQRLVEFDVTDDEDSDTKENPVPQTDSNTSRKN
FT                   IEDVGKQSSPSTSTNDDSQTLNVKNTISDVKNSEQSGGAEKLPSNIAMSVTEAIDEQRL
FT                   RTEIQIKQTLEAKLAAKVATVSVTNRIQAKGTSFSTTVDIPTTSEVPTIFTVESIGKSD
FT                   TLGLKFDGMPAYMSATSQAMGFGIGAARFVLVSEGFPMRIEFRLDAQPAPMIGSIVADT
FT                   VNPSEASKRNEALTLKMIDTMFKIYNACQIFVKDIKLTRPFGIEAYAGDLVTELHMLGS
FT                   KFINQSRPVLPAVGYCDRTDYVRERVRGLFTEEENRMHLGVINDAGAERLLIFRDVACV
FT                   TDQWFATLNRQFYQFINDRRVDLPSFLAQLRIFAFPNTTITLEDEAQYDFHYWPNWRRE
FT                   DCYGAVLMYALSVSRQKQYYDHLVELLQRINVVKVRKPSDLTREIPSLASIDDRKIMEI
FT                   INQIGSEFQDYDIFRALSADISTTWMDVEIKGLEADATAFQAIFRVFTVMLWFNLFPAI
FT                   AVDCAPTLMYILFRAMSVLIPTETRAYCEQFGFTTLPRYHTVSNIPPLVPYQRGDYTFP
FT                   ILQAPPNAGNLLHFGRLHRLLILNNVVQTQTRDTPDIQIPRMADVRAYIQPWEFQPFTV
FT                   PGETRFGARLSDIYAFCKDLIHAYSTTTVRGVAPKGTFGSDGTRAAAMTDFFNYLSADM
FT                   LSTKFASRVHCELFRLRELGQNSLYNMGDTYQGTLAMRNERPLVFGRDRNQRWTSFPFK
FT                   RSKETFGFFLPFYALLAVDGLTGMEAYVTPPNVAAEFEKMRMIQREGMLFGDILTFTQL
FT                   VMFGDGNQFRRDLRRTTGDYMSKTRFSIVLRYLAQTLKFMIGDLFTNAVRDIERDLDSR
FT                   AGAFQISLSPFYAPANQPQPQVQGTLYGENLELSRPFTEQAFDTISMLFTPETAPIALF
FT                   SRGLFITRRHVTTFDPDTAIDIDEFLRVNPDTVIHVWSPDLVRTQMIDNTFRRSAYTLA
FT                   ITINGEQQMFTAPTQQMPNVLLLVTARSGPINTRYLKFLKTFFQQQKVHFLFPDLLVAR
FT                   DRIVTTSAAYDVDLESQFDEICGGSPSVQRVIRMYDTTVYHAMGDLWSPSEKWFYLAEP
FT                   ARNNDLIIKGATHLTTHDGERFVTGPPTMWAYGQNGGQTIRHENADDEAQQGQINKLLI
FT                   GNVNYNNVVRTIVDEMVLRPPKFTVDESSLLDSTFAINHDL"
XX
SQ   Sequence 3780 BP; 1106 A; 760 C; 859 G; 1055 T; 0 other;

DQ192236  Length: 3780  November 1, 2005 08:47  Type: N  Check: 8837  ..

       1  aaataaatct ccggacaggc acacaataca actgatcgct cgctgtaact
      51  ttacgacaac catccctaca cgtaaccatg gaaacacaac agaaaactaa
     101  gaaaacaaag aaggttcaac gtcttgtaga atttgatgtc actgatgacg
     151  aagactcgga tacaaaggag aatccagtac cacaaactga tagtaataca
     201  tcgcggaaaa atatcgagga tgttggaaaa caatcaagcc catcgacgag
     251  tacaaatgat gatagtcaaa ctttaaacgt caagaataca attagtgatg
     301  ttaaaaactc cgagcaatct ggtggtgctg agaaattacc aagtaatatt
     351  gcaatgtcag taactgaagc gattgatgaa caacggttac gaacggaaat
     401  ccaaataaaa cagacgttag aggcaaagtt agcagcaaag gttgcgacag
     451  tatcagtaac taaccgtatt caggcgaagg gtactagctt cagtacaact
     501  gttgacattc caacgacaag tgaggttcca accatattta cagttgaatc
     551  aattggaaag tcagataccc ttggtttaaa atttgacgga atgccggctt
     601  atatgagtgc gacgagtcaa gcaatgggat ttggcattgg tgcggcacga
     651  tttgtattgg tttcggaagg atttccaatg aggattgaat ttagattaga
     701  cgctcaacca gctccgatga ttggtagtat tgttgctgat acggtaaatc
     751  cttccgaagc aagtaaacga aatgaggcct taaccttaaa aatgattgat
     801  actatgttta agatttacaa tgcatgtcaa atttttgtta aagatattaa
     851  attaacgcga ccgtttggga ttgaagcata tgcgggcgat ctagtaactg
     901  agctacatat gttgggttcc aaatttatta accaatcaag accagttctt
     951  ccagcggttg ggtattgtga cagaaccgat tatgttcgcg aacgtgtaag
    1001  gggtctcttt accgaggaag aaaatcggat gcatctcgga gtaattaatg
    1051  atgctggcgc ggagaggtta ctaatttttc gtgacgttgc atgtgtgaca
    1101  gatcaatggt ttgcaacgtt aaacagacaa ttttatcaat tcattaatga
    1151  ccggcgtgtt gacttaccat cttttctagc tcaattgcga atctttgcat
    1201  tcccaaatac aactatcacg cttgaggatg aagcacaata tgactttcac
    1251  tattggccta actggcgtcg ggaagattgt tatggagccg tgttaatgta
    1301  tgcattatcc gtgtcacgcc aaaaacagta ctatgaccac ttagttgagc
    1351  tgttgcagcg gattaacgtt gtgaaagtac gaaaaccctc ggacttaact
    1401  cgagagattc caagtctagc ttcaattgat gataggaaga tcatggaaat
    1451  tatcaatcag attggcagcg agtttcagga ttatgacatt ttccgtgcgt
    1501  tgagtgcaga catttcaaca acttggatgg atgttgagat caaaggtctt
    1551  gaagcagatg cgacggcttt tcaggcaatt tttagagtgt tcacggtcat
    1601  gctatggttc aatctcttcc cagctattgc agttgattgc gcgccgacct
    1651  tgatgtatat tttattccgt gctatgtcag ttttaatacc gaccgagacg
    1701  cgtgcctact gtgagcagtt tggttttaca acgctgccaa gataccatac
    1751  ggtttcaaac atcccaccat tagtaccata tcaacgtggc gactatactt
    1801  ttccaatctt acaggcccca ccgaacgctg gaaatctgct ccattttgga
    1851  agactccatc ggttattgat tttaaataat gtagtccaaa cccaaacgcg
    1901  ggacacgcct gatattcaaa taccaaggat ggctgacgtg cgtgcatata
    1951  tccagccatg ggaatttcag cctttcacag taccaggtga gaccagattt
    2001  ggggcacggt tgtcagacat ctatgctttt tgcaaagact taattcacgc
    2051  atactctaca acaacagttc gtggcgttgc accaaaaggc acgttcggtt
    2101  cagatggaac tagagctgct gcaatgacgg acttctttaa ttacttatcg
    2151  gctgacatgc taagtaccaa atttgcgtca cgtgtccact gtgaactgtt
    2201  cagactgcgc gagcttggtc aaaattcctt gtacaatatg ggcgacacgt
    2251  atcaaggaac tctggcgatg cggaatgaga ggcccttggt ttttggacgt
    2301  gatagaaatc aaaggtggac gtccttccct tttaaaagat caaaggagac
    2351  gtttggattt ttcttaccgt tttatgctct cctggctgtt gatgggttga
    2401  ctggaatgga ggcgtacgtt acaccaccaa acgtcgcagc tgagtttgag
    2451  aagatgcgta tgatccagcg tgagggcatg ttgtttggtg atatcttgac
    2501  gtttacgcag ttagtgatgt ttggtgatgg aaatcaattc cgacgtgact
    2551  tgcgacgtac aactggtgac tacatgagta aaacgagatt ttcaattgtg
    2601  ttgagatatc tggctcaaac gttgaagttt atgattggcg atttgtttac
    2651  aaatgcagta cgtgacatag aacgtgatct tgatagccgt gctggagcgt
    2701  ttcaaatctc attgtcacct ttttatgcac ccgcgaacca gccacagcct
    2751  caggtccagg gaacactata tggtgagaat ctcgagttga gtaggccttt
    2801  caccgaacaa gccttcgata caatttcaat gttgtttaca cccgagactg
    2851  cacccattgc cttgttctca cgcggattgt tcatcacgcg tcggcatgtg
    2901  acaacatttg atccagatac ggcaattgac attgatgagt ttttacgagt
    2951  caaccctgat acggtaattc atgtttggtc acccgacctt gtacgcaccc
    3001  aaatgattga taacactttc agaagatcag cgtacaccct cgcaattaca
    3051  atcaacgggg agcagcaaat gttcactgcg ccaacccagc aaatgccaaa
    3101  tgtcctgcta ctcgttacag cacgttcagg tccaattaac acgaggtatt
    3151  tgaagtttct taaaactttc tttcaacagc agaaagtgca tttcttattt
    3201  ccagatttgt tagtggcgcg tgatcgcatt gttacaactt cggccgcgta
    3251  tgatgtagat ttggaatcgc aattcgatga gatttgtggg ggatcgccat
    3301  ctgttcagcg tgtcattagg atgtatgata cgacggtcta ccacgcaatg
    3351  ggtgatcttt ggagcccaag tgagaaatgg ttttatctag cagaaccagc
    3401  tcgtaataat gatttaatta tcaaaggtgc gacacatcta acaactcatg
    3451  atggtgagag attcgtgaca ggacctccaa cgatgtgggc atatggacag
    3501  aatggtggac aaacgataag acacgaaaat gcagatgatg aagctcaaca
    3551  aggtcaaatt aataaattat taattggaaa cgtcaactat aacaatgtcg
    3601  ttcgtactat tgttgatgaa atggttttaa ggccgcccaa gtttacagtt
    3651  gacgaaagct cgctactaga ctcaaccttc gctattaacc acgatttgta
    3701  accacgctga tggatgtcct aagttaagtc cgttaggttg gttgtgtgac
    3751  taatcgtaac tatcggagat tgggtaggtt