Sequence of DPV Operophtera brumata idnoreovirus

Operophtera brumata reovirus segment 3, complete sequence.

ACC No: DQ192237

Dated: 2005-10-29 | Length: 3595 | CRC: 398865708

                !!NA_SEQUENCE 1.0
ID   DQ192237   standard; genomic RNA; VRL; 3595 BP.
XX
AC   DQ192237;
XX
SV   DQ192237.1
XX
DT   29-OCT-2005 (Rel. 85, Created)
DT   29-OCT-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Operophtera brumata reovirus segment 3, complete sequence.
XX
KW   .
XX
OS   Operophtera brumata reovirus
OC   Viruses; dsRNA viruses; Reoviridae; unclassified Reoviridae.
XX
RN   [1]
RP   1-3595
RA   Graham R.I., Rao S., Possee R.D., Sait S.M., Mertens P.P.C., Hails R.S.;
RT   "Detection and characterization of three novel species of reovirus
RT   (Reoviridae), isolated from geographically separate populations of the
RT   winter moth Operophtera brumata (Lepidoptera: Geometridae) on Orkney";
RL   Unpublished.
XX
RN   [2]
RP   1-3595
RA   Graham R.I., Rao S., Possee R.D., Sait S.M., Mertens P.P.C., Hails R.S.;
RT   ;
RL   Submitted (04-SEP-2005) to the EMBL/GenBank/DDBJ databases.
RL   Molecular Biology, Institute for Animal Health, Ash Road, Pirbright,
RL   Woking, Surrey GU24 0NF, United Kingdom
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3595
FT                   /db_xref="taxon:352248"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Operophtera brumata reovirus"
FT                   /segment="3"
FT   CDS             16. .3501
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /protein_id="ABB17207.1"
FT                   /translation="MADLTQLDVHEWLDSTRYPLTFTLPLTSIAPTILLDEYVGLLRTS
FT                   ELFSLTWRNNHLEISFLNAFAIVGFEPTTFLLQTEYDRIEIVRMLVRGITRRLKIMKLG
FT                   LENLSTNDLIQVIKDETVGTSLWQLIENIHLLQARLLQTFSPTNLKYLSPILVSHWIEK
FT                   ALTHPTQITSTIFWKMVSFDGTVSWTSLLNYCLAIALGQTERDDIVIRTWPMTSMYPIT
FT                   HVLVTPGVQKPALNYVIAWYPTFKTHKDLKHFMRRQGFMTAHLIPNFGIFHVHEFQTIS
FT                   ALVHYMIENVRTSQLEKRRLYERTTDSPFIRFTRSVLFTDSVPPAVLYLNMLIGLSSVL
FT                   SLPNELKTYFDWDVFIRRLISSDLLRFTQLSFRYSDSPIPTFLHTYVTEIVDAYGQHHD
FT                   ENQDFFVTLIRDVLNEMTPIDIDCVVDEDNGEIATPIFEDSVVFSELPLSSHSLDLTAV
FT                   NLRPSVHVLPTIQAHMRNYQSSQFRGIIMTCPRGTPIADPIMVDITRIRRLAELRSIMS
FT                   FEYRRFSQPDYLAKIFIDNDGVTDMIVDFLTGFMAVTLYEDDIHFTYEEGDLIQLALTY
FT                   RRALLQKKPNAVNGSTPKLAEILAMTIEIIDTTDVFSLSEIARRDHLNASMRKVLILGA
FT                   TGLGDPIARGLKKIFKSTVRQIGAFGTGSVTRGLIESVELSQGYTSVLSDMDFSGITNE
FT                   AQFDAHVRSSLVEIINLIQPNILIWKLQYATMALLNRIFTLLATLNLGYRAYIMRSSFS
FT                   HIANFEWYLVLLKPLFDQNANMSFVPPVGITAMSVLTKRPLMVTTTIVKEDEILTPSVL
FT                   ELNNVMTSVGMFDFGKIRENLSILMRYMSSVQIARVGYGTDMSYLGRISRQRQMLTYRT
FT                   NVAYEILPNLPTRLAPSTIGLLRGKRVLATMALTLGNYVRAITREVMTRTIQTKHTTLS
FT                   TKNRTNEDLLFIGVGDENVRNVGSVFLNSRYIVVDPRANPQLDVFNIEIARFELDWNYE
FT                   TMRESVLTFKGNTNKVILFFLFMLMNDEPTKDELTHRLTNIRNLVLHTPEISEIYFNVY
FT                   LSDPFVNDHARYTDGATRNRVGDDLYFTVNQEGNVRVTFSERYDPVVTMSYDELQKIFA
FT                   LEAHPDARLTRLGLLDQDAFCLYKRDGSVLTQTALPFLEFGYSACPLFSYQRVA"
XX
SQ   Sequence 3595 BP; 1027 A; 699 C; 734 G; 1135 T; 0 other;

DQ192237  Length: 3595  November 1, 2005 08:47  Type: N  Check: 8057  ..

       1  aaataaaacc caacaatggc ggatttgacc caacttgatg tacatgaatg
      51  gctcgatagt acacgttatc cacttacctt tacattacca ctcacaagca
     101  tagcaccaac gatattactg gatgaatacg taggattatt acgaacaagt
     151  gaacttttta gcttgacatg gcggaataac catttagaaa tatcgttttt
     201  aaatgcattt gcaattgtcg gttttgaacc aacaaccttc ctacttcaaa
     251  cagaatacga tcggattgag atagtgcgaa tgctggttcg cggaatcact
     301  cgaaggctga agattatgaa actcggattg gagaatttat ccacgaacga
     351  tttgattcaa gttattaaag atgagaccgt tggaactagc ttatggcagt
     401  taattgagaa tattcattta ttgcaagcac ggctactcca gactttttcc
     451  ccaacaaact taaagtattt atctccaatt ttggtttctc attggattga
     501  aaaagccctg actcatccaa ctcagatcac atctacaatt ttttggaaga
     551  tggtaagttt tgatggaact gtttcctgga catcgttact caattattgc
     601  ctagcgatcg ctttaggtca aactgaaaga gatgatattg tgatacgaac
     651  atggccaatg acatcaatgt acccaatcac gcatgtactt gtgacaccag
     701  gtgtccagaa accagcgctt aattatgtta ttgcatggta tccaactttt
     751  aagacccata aagacttaaa gcatttcatg cgacggcagg gtttcatgac
     801  agctcatctc attccaaatt tcggaatatt tcatgtccac gagtttcaaa
     851  ccattagcgc ccttgtgcat tacatgattg agaacgttcg tacatctcaa
     901  cttgaaaaac gcagactgta tgaaagaaca acagattcac catttattcg
     951  atttacacgc tcagtgttat ttactgactc agtaccacca gcagttttgt
    1001  atttgaatat gctaattgga ctatcttcag tattgagttt acccaatgag
    1051  ttgaagacct attttgactg ggacgtgttt attcgcagat tgatttcatc
    1101  tgacttattg cgattcacac agctatcttt tagatattct gactcaccga
    1151  tcccaacctt tttgcataca tatgtaactg agattgttga tgcttatggt
    1201  cagcatcatg acgaaaacca agatttcttt gttacgttaa ttcgtgatgt
    1251  acttaatgag atgacaccaa ttgatatcga ttgtgtggtt gatgaggata
    1301  atggcgaaat cgcgacacca atattcgagg atagtgttgt atttagtgaa
    1351  ctcccacttt cttctcattc gcttgattta actgcagtta accttcgacc
    1401  aagtgtacac gttcttccaa ctatacaagc tcacatgcgt aattaccagt
    1451  cctcccaatt ccgaggtatc ataatgactt gcccaagagg gacgccaatt
    1501  gctgatccaa ttatggtcga tattactcgt atccgtcgtc tagcagagct
    1551  gcgttcaatt atgtcgttcg aatatcgacg tttttcccaa ccggactatc
    1601  tagcgaagat atttattgac aatgatggag tcacggacat gattgttgat
    1651  ttcttaactg gtttcatggc ggttactctc tatgaagacg acattcattt
    1701  cacttatgag gaaggcgatt tgattcagct agctctcact tatcggcgag
    1751  cattacttca gaagaaacct aacgctgtta atgggtcaac accgaaatta
    1801  gctgaaatat tggcgatgac gattgaaatt atcgatacaa ctgatgtctt
    1851  tagtttaagt gagattgcgc gccgtgatca tttgaatgca agcatgcgga
    1901  aggtattgat tcttggtgcg acaggtttag gtgatccaat tgcacgtgga
    1951  ctgaaaaaga tttttaaatc aacagttcgt caaataggtg cgtttggtac
    2001  aggttcggtt actcggggat taattgaatc agttgagtta tcacaagggt
    2051  atacttctgt tctttctgac atggattttt ccggtattac aaatgaagcc
    2101  caattcgatg cccatgttag atcaagctta gttgagatta tcaacttaat
    2151  tcaaccaaat atattaattt ggaaattaca gtacgcgaca atggcgttgc
    2201  taaatcgaat tttcacattg ttagcaacat taaatcttgg ataccgtgct
    2251  tatattatgc ggtcaagttt ttcccatatt gcaaactttg agtggtattt
    2301  ggtgttattg aaaccacttt tcgaccagaa cgccaacatg tcttttgtac
    2351  caccagtggg gatcactgct atgtcagttc tcacgaaacg accattaatg
    2401  gtgacaacta ccatcgttaa agaggatgaa atattaactc caagtgttct
    2451  tgaattaaac aacgtcatga cctctgttgg aatgtttgat tttggaaaga
    2501  tacgtgagaa cttaagcatt ctaatgcgtt atatgtcttc agttcagatt
    2551  gcacgtgttg gttatggtac tgacatgtct tatctcgggc gtatcagtcg
    2601  tcaacgtcag atgttgactt accgcactaa tgtcgcttac gaaatactac
    2651  ctaatttgcc tactcgttta gcaccatcca caattgggtt actaagaggg
    2701  aaacgtgttc tagcaacaat ggcattgact ttgggtaatt atgttagagc
    2751  tattacacgc gaggttatga ctcggacgat tcagaccaaa catacaactc
    2801  tttcaactaa gaatcgtact aatgaagact tgttatttat tggtgtgggt
    2851  gatgaaaatg tacgtaatgt cggttcagta tttcttaatt cacgctacat
    2901  tgtcgttgac ccacgtgcta acccacagtt ggatgtgttt aatattgaga
    2951  tcgcaagatt tgaacttgat tggaattacg agacaatgcg agagagtgta
    3001  ttgacgttca aagggaatac aaataaagtt attttattct tcctatttat
    3051  gctaatgaat gacgagccaa caaaagatga gttaactcat aggttgacga
    3101  acataaggaa tttagtactt cacacacctg agatttctga gatctatttt
    3151  aacgtatacc tgtctgatcc atttgttaac gatcacgccc ggtatactga
    3201  cggcgccact cggaatcggg ttggtgatga tctctacttt accgtcaatc
    3251  aggaaggtaa tgtacgcgtg acgtttagtg agcgatacga tcctgttgta
    3301  acgatgtcat atgatgaatt gcagaaaatt tttgcgctgg aagctcaccc
    3351  tgacgcgaga ctaactcgtt taggattact cgatcaagat gctttttgtt
    3401  tatataagcg cgatggctcc gtattaaccc aaactgcttt accgtttctc
    3451  gagtttggtt atagtgcatg tcctctgttc tcgtatcagc gagtagcgta
    3501  agttattcgc aggtgtgtgg acacgtgtgt attccctgca gttgcacaag
    3551  attgggcgtc cctccgggtt acgacggatt gggttgatgg aggtt