Sequence of DPV Operophtera brumata idnoreovirus

Operophtera brumata reovirus segment 4, complete sequence.

ACC No: DQ192238

Dated: 2005-10-29 | Length: 3362 | CRC: 533751198

                !!NA_SEQUENCE 1.0
ID   DQ192238   standard; genomic RNA; VRL; 3362 BP.
XX
AC   DQ192238;
XX
SV   DQ192238.1
XX
DT   29-OCT-2005 (Rel. 85, Created)
DT   29-OCT-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Operophtera brumata reovirus segment 4, complete sequence.
XX
KW   .
XX
OS   Operophtera brumata reovirus
OC   Viruses; dsRNA viruses; Reoviridae; unclassified Reoviridae.
XX
RN   [1]
RP   1-3362
RA   Graham R.I., Rao S., Possee R.D., Sait S.M., Mertens P.P.C., Hails R.S.;
RT   "Detection and characterization of three novel species of reovirus
RT   (Reoviridae), isolated from geographically separate populations of the
RT   winter moth Operophtera brumata (Lepidoptera: Geometridae) on Orkney";
RL   Unpublished.
XX
RN   [2]
RP   1-3362
RA   Graham R.I., Rao S., Possee R.D., Sait S.M., Mertens P.P.C., Hails R.S.;
RT   ;
RL   Submitted (04-SEP-2005) to the EMBL/GenBank/DDBJ databases.
RL   Molecular Biology, Institute for Animal Health, Ash Road, Pirbright,
RL   Woking, Surrey GU24 0NF, United Kingdom
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3362
FT                   /db_xref="taxon:352248"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Operophtera brumata reovirus"
FT                   /segment="4"
FT   CDS             15. .3290
FT                   /codon_start=1
FT                   /product="polyhedrin"
FT                   /protein_id="ABB17208.1"
FT                   /translation="MSSLVNIPIPNPLTPHDDELHLALASVSRQLRLLRRRQIQAGQSN
FT                   NQSTSPAISVSIPDQPSTIGDQSSTPPKLVKQQFGLSQPLVEPGNFSDTEIDIDLLLRA
FT                   AIDSIGRLRITARHELRIEQLTPKLYRHPMREFQDLNRLPGNLFYFPAVILPRVKRMQS
FT                   FDTKFVFEDHLFQLNHLQLYALHVGETKYVKLGYLEDVKFTYPEDSDSVSVLPNNNPVL
FT                   TDAPRIYYQMNEVGYNEILLVYPQLPTNVKLSLNERCLVSYFVGLRCCLWMSLFQLDRN
FT                   DLIDTSRTPLNDLEDDLFHLTSKISKLSQASFRPSVLQFDSTVGQQLFNLVVDVQTQGR
FT                   LLLTTNQFLTSTSADDRNLFNQLDVQSLSLADRLSNVLLNPKDSFTFTRITGGQSVQCK
FT                   LPTTAVMEVVPADTNSIRYEKTHPMKFLVVERQLSGDRRVYVHSLTLEDAARLRATPRS
FT                   AEGKSFDDEFGVEYTVFRIVAVVSDIESPTVNISFYVQDHEANVFGVNSEKCRANTKIS
FT                   LKTTRREGLSDLSDGSAVVELEANSLQTSLGYYRVGGYEGVFHKLTTEPLFTKMSREDP
FT                   SVAILGTLMYAPQISKHGMRNIFPFRSKHSVPYVQTRWIPSDLFAEAIGVEEAHIEVDC
FT                   SEFSVHLLLNPYGYTSDRLVNADVFTDDRFRQISSLLRNQEMFDSIGLILGRLHTIEET
FT                   LSHLISTVNDVVSHVRVLSKAFQDATNVPWWKKALNGLSSLTGLIGMIVMPFCPIAGIG
FT                   LLALSGGISMGLAFSSGDYVAGAIDAVGIVLSVGLGGMQTRIINRASYSALDSTKLIST
FT                   PIELNESIRQTLLTDEGLMIETRPLQMLGPKVGTVGALLKRKVPFFHKWLLKYDTAPVH
FT                   ARVVNKITRRIGSKYVRINTYSGVADGLPEMAHLTARPGHFELRNVIDENSGKLTPNWD
FT                   SFEVDNYSTFESLPLKVQGTILEGSENGYEFQRMSEFWKVASDSEKRLALVDAQKYIER
FT                   FNLPEYTPELHTAIRSRFDETLFSNVTDVFAKHFPLYELTGITNPIGANNCQTYTREIR
FT                   NFFAQGKLTKVKLNNTGFLRDLMMAFRNSDEFSLRYTPAVFTS"
XX
SQ   Sequence 3362 BP; 983 A; 653 C; 696 G; 1030 T; 0 other;

DQ192238  Length: 3362  November 1, 2005 08:47  Type: N  Check: 1164  ..

       1  aaataaatcc cattatgtca agcctcgtca atataccaat tcctaaccca
      51  cttaccccac acgacgatga attacacctt gcacttgcct cagtttctag
     101  acaactccgc ttactcagac gtcgacaaat acaagcaggt cagtcaaata
     151  atcagtcaac atctcccgcc attagtgtgt caatcccaga tcaaccatct
     201  acgattggag atcaatcatc aacaccacct aagttagtta aacaacaatt
     251  tggattatca cagccgttag ttgaacctgg aaacttctca gatacagaga
     301  ttgatattga tctactttta cgagcagcta ttgattcgat tggacgatta
     351  cgaatcacgg cacgtcatga attacgaatt gaacagctta cccctaagtt
     401  gtatcgtcat ccgatgcgtg aatttcaaga tcttaaccgg ttaccaggta
     451  atttgtttta ttttccagca gttatacttc cacgtgttaa acgtatgcaa
     501  agtttcgata caaagtttgt ttttgaggat catcttttcc aacttaacca
     551  tcttcaactc tacgcattac acgttggtga aaccaaatat gtaaaacttg
     601  gatatttaga ggatgtgaaa tttacctatc cagaagatag tgactcagta
     651  tctgttctac ccaataataa tccagtactt accgatgcac cacgtatcta
     701  ctaccaaatg aatgaagttg gatataatga aattttatta gtttatcctc
     751  agctaccgac caatgtgaaa ttatcactga atgaaagatg ccttgttagt
     801  tattttgttg gtttacggtg ctgtttatgg atgtcgctat ttcaacttga
     851  tcgtaatgat ttaattgata caagtcgtac accattgaac gatcttgaag
     901  acgatttatt ccatttgacg tcaaaaatat caaaactgtc gcaagcatct
     951  tttagaccca gtgttctcca atttgattca actgttggtc agcaactatt
    1001  caatctggta gtagacgtcc aaacacaggg aagattgtta ctaacgacta
    1051  accaattcct tacgtcaacc tcagctgatg accgtaatct gtttaatcag
    1101  ttagatgttc aatcattatc attggctgat cgactatcga atgtattatt
    1151  aaacccaaag gatagtttca cctttactcg aataactggg ggacagtcag
    1201  ttcaatgcaa actaccaaca actgccgtca tggaagtggt acctgctgac
    1251  accaatagta ttcgttatga aaagacacat ccgatgaagt ttttagttgt
    1301  tgagcgacaa cttagtggcg acagacgtgt gtacgttcat tcattaaccc
    1351  ttgaggacgc agcaaggtta cgagcaacac cacgttcggc tgaaggaaag
    1401  tcatttgatg atgagtttgg agttgagtat acggtattca gaattgtagc
    1451  tgtcgtcagt gacatcgaat ctccaaccgt gaacatttca ttttatgtgc
    1501  aggatcatga ggcaaatgtt tttggtgtga attctgagaa atgtcgtgca
    1551  aatacaaaaa tttctttaaa aacaacacga agagagggtt tgagcgatct
    1601  ttctgacggt tcggcagttg ttgagctcga agccaatagt ttgcaaactt
    1651  cacttggata ttaccgtgta ggaggttacg agggtgtttt tcataaatta
    1701  acaaccgaac ccttatttac aaaaatgtct cgagaggatc catcagttgc
    1751  gatactcggg actttgatgt atgctccaca aattagtaag catggtatga
    1801  ggaatatctt tcctttccga agtaaacatt cggtacctta tgtacaaaca
    1851  cgttggattc caagtgacct gtttgccgag gctattggtg ttgaggaagc
    1901  acatattgaa gttgattgtt ctgagttttc ggtacatcta cttttaaatc
    1951  catacggcta tacatcagat agattggtta atgctgatgt ttttactgac
    2001  gaccgcttcc gtcaaatctc atccctacta cgcaatcaag aaatgtttga
    2051  ttcaattggc cttattctcg gaagattgca tacaattgaa gagacattat
    2101  ctcacttaat ttcgaccgtt aatgacgttg tttcacatgt tagagtattg
    2151  tctaaggctt ttcaggatgc aacgaacgtt ccttggtgga aaaaggcttt
    2201  gaatgggtta agttcactta ctgggttgat tggaatgatt gttatgccat
    2251  tttgcccgat tgctggaatt ggactcctgg ctttaagtgg cggcatttct
    2301  atgggtttag ctttctcttc tggtgactat gttgcaggtg ctatcgacgc
    2351  agttggaatt gtcttatcgg ttggccttgg cggaatgcag actagaataa
    2401  ttaatcgagc gtcatattca gcgttagatt caactaaatt gatctcaaca
    2451  ccaattgaac tgaatgagag catacgacag accctactga ctgacgaggg
    2501  cttgatgata gaaacacgac cattacagat gcttggtccg aaagttggta
    2551  cagttggggc actactgaag aggaaagtgc ctttctttca caaatggctt
    2601  ttgaaatatg atactgctcc agtacatgct agagttgtca ataagattac
    2651  acgaaggatt ggatcgaaat atgtacgcat taatacctat tcaggtgttg
    2701  ctgatggatt accagagatg gcacatctga cggcacgccc aggtcatttt
    2751  gagttacgca acgttatcga cgagaacagt ggcaagttga cacctaattg
    2801  ggattcgttt gaggtcgaca attattcaac ttttgagtct ctaccattaa
    2851  aagtgcaagg gacaatactt gaaggtagtg aaaacggtta tgaattccaa
    2901  cgcatgtcgg agttctggaa ggttgcttcg gacagtgaga aacgtcttgc
    2951  attagttgat gctcaaaagt acattgaaag atttaatctt cctgaatata
    3001  caccagagct tcatacagca attagatcac gatttgatga gacacttttc
    3051  tcaaatgtca ctgatgtttt tgcgaagcat tttccattat atgagttaac
    3101  tggtattacg aacccgattg gagcgaataa ttgtcaaacc tacactcgtg
    3151  agattagaaa ctttttcgct caaggaaagt tgacaaaggt gaagttgaat
    3201  aataccggat ttttacggga tctaatgatg gcatttcgta actcagatga
    3251  atttagtcta cgctacacgc ctgcagtatt cacgtcgtag tgcgttcgtg
    3301  gtccgaagtg ttattggctg cttgaggttg gagttgaacg cccaaccggg
    3351  attgtgtagg tt