Sequence of DPV Operophtera brumata idnoreovirus

Operophtera brumata reovirus segment 6, complete sequence.

ACC No: DQ192240

Dated: 2005-10-29 | Length: 1935 | CRC: -1088293910

                !!NA_SEQUENCE 1.0
ID   DQ192240   standard; genomic RNA; VRL; 1935 BP.
XX
AC   DQ192240;
XX
SV   DQ192240.1
XX
DT   29-OCT-2005 (Rel. 85, Created)
DT   29-OCT-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Operophtera brumata reovirus segment 6, complete sequence.
XX
KW   .
XX
OS   Operophtera brumata reovirus
OC   Viruses; dsRNA viruses; Reoviridae; unclassified Reoviridae.
XX
RN   [1]
RP   1-1935
RA   Graham R.I., Rao S., Possee R.D., Sait S.M., Mertens P.P.C., Hails R.S.;
RT   "Detection and characterization of three novel species of reovirus
RT   (Reoviridae), isolated from geographically separate populations of the
RT   winter moth Operophtera brumata (Lepidoptera: Geometridae) on Orkney";
RL   Unpublished.
XX
RN   [2]
RP   1-1935
RA   Graham R.I., Rao S., Possee R.D., Sait S.M., Mertens P.P.C., Hails R.S.;
RT   ;
RL   Submitted (04-SEP-2005) to the EMBL/GenBank/DDBJ databases.
RL   Molecular Biology, Institute for Animal Health, Ash Road, Pirbright,
RL   Woking, Surrey GU24 0NF, United Kingdom
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1935
FT                   /db_xref="taxon:352248"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Operophtera brumata reovirus"
FT                   /segment="6"
FT   CDS             63. .1847
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /protein_id="ABB17210.1"
FT                   /translation="MIETVQTTNYYLLWEHMQRSTELLTKLTGISQPTESKYITVRRSF
FT                   GTRLARLFDIHGSKYPDQFLLQVRRHRRLGICIYMAYPKVSTVKEALRKAGSTKPTVNV
FT                   LKSGGTDNQFWASISSYDATVISDLTGSNGLELFVLTLDEKTKALKQLAMSMNHAQQYK
FT                   QLVVMLPKIDVQSMINFNPWYQGVDAPMVVGIGIVKKEIPLWYQVLDAYATVTLFTKEG
FT                   ALNLRVVNDHVSTISCAIPSCVLEYNRDAFYVHDHVDPNFPHETNQNRSLFLTKQRFTS
FT                   GSCFEYCIADSRHQRRFVFGNAFIIDEHLSRLSKTHVEVIEDDIWQWFEFNSFNVHYEP
FT                   RRPEKQLVNALQLRAVSDRQYQFSLRLDEVLHKVTQRMCRLTIVAPKASGKSYFSNYMA
FT                   THFPEVNVIDSDDFGIWIAGKAVGMQFSVIESIVSDVSIFDQLIVGHFLQGLDAKTLDK
FT                   RSSFDEILTIVDKLDWDFTNFVRDWMAIMAKGIGSLGFSDYVRHRHLEQPATLGIALCH
FT                   THSEARLLIADYTVRIRHTLLGHYAFWKRVIHQKLTLRQALTQRVLTWLYELDENSTEP
FT                   NVTWCNVIHSLSNRSPCT"
XX
SQ   Sequence 1935 BP; 567 A; 368 C; 442 G; 558 T; 0 other;

DQ192240  Length: 1935  November 1, 2005 08:47  Type: N  Check: 7480  ..

       1  aacaaatctc ccaccggtat agcctatgac attgagatga gatatgagcc
      51  gacatacgca ccatgattga aactgtacag acaactaact actacttact
     101  ttgggaacat atgcagcgca gtactgagtt attgacaaag ttgaccggca
     151  tctcccagcc tacggaatca aagtatataa cagttcgtcg atcatttggg
     201  acgagactcg cacgattatt tgatattcat ggctcgaagt atccagatca
     251  attcttactc caggtcagac ggcacagaag actcggaatt tgcatctata
     301  tggcgtatcc aaaggtgtca accgttaagg aagcgttacg aaaagcggga
     351  agtacaaaac caaccgtcaa tgttctcaag agtggtggca cagataatca
     401  attttgggca tcgattagta gctatgatgc gaccgtaatt agtgatttaa
     451  cgggatcaaa tggtttagag ttgtttgtct taacgttaga tgagaagact
     501  aaagcgttaa agcagttagc aatgagcatg aatcacgcac aacagtacaa
     551  gcaattagtt gttatgctcc cgaagattga tgttcagtcg atgattaact
     601  ttaatccgtg gtaccaagga gttgatgcac caatggtcgt gggtattgga
     651  attgttaaaa aggaaattcc gttatggtat caagttctgg atgcgtatgc
     701  aaccgttaca ttatttacga aagaaggtgc actcaatctt cgtgttgtga
     751  atgaccacgt gtcaactatc agctgtgcaa taccatcctg tgttttagaa
     801  tataatcgag acgcatttta cgttcacgat cacgttgatc caaactttcc
     851  acacgaaacc aaccagaaca gaagtctgtt tttaacaaaa caacgattta
     901  cttcaggttc ctgttttgaa tattgtatcg cagacagtcg tcatcaacga
     951  cgatttgttt tcggaaacgc ttttattatc gatgagcatt tgagtagact
    1001  ttcaaagaca cacgttgagg ttattgagga tgacatatgg cagtggtttg
    1051  aatttaattc atttaatgtt cattacgaac cacggaggcc ggagaaacag
    1101  ctagtaaacg cgttgcagtt acgggcagta tctgatcgtc agtatcaatt
    1151  cagcttacga cttgatgagg ttttacataa ggtaactcaa cgaatgtgtc
    1201  gactaacaat tgttgcgcca aaggcgtccg gaaagtcata tttcagtaat
    1251  tatatggcaa ctcatttccc tgaagttaac gtaatcgact ctgatgattt
    1301  tggaatatgg attgcaggta aggctgttgg gatgcaattt agtgttattg
    1351  aatccattgt atcagacgtt tcaatttttg atcagttgat tgtcggtcat
    1401  tttcttcagg gtttagacgc gaaaacatta gataaaagaa gctccttcga
    1451  tgaaattctt actattgttg ataagttgga ttgggatttc actaacttcg
    1501  tacgtgattg gatggctatt atggctaagg ggatcgggtc attggggttt
    1551  tcagattacg ttcgacatcg acatcttgag caacctgcaa cgttggggat
    1601  tgcgttgtgt cacactcact cagaagcgcg actactaatc gctgactata
    1651  ccgttcgaat cagacatact ttacttggtc actacgcctt ttggaaaagg
    1701  gtaatacatc agaagttaac cctgcgtcag gcattaactc agcgggtttt
    1751  gacgtggttg tacgagctgg atgagaattc aactgaacca aacgtgacat
    1801  ggtgtaacgt gatccactca ttatcgaata gatctccttg tacgtaggac
    1851  actgaccgta taagtggagg ttcgccagtc ccttcagcaa ggattggacc
    1901  acgaaagcgc gaaggcacca gggagttggt aggtt