Sequence of DPV Operophtera brumata idnoreovirus

Operophtera brumata reovirus segment 7, complete sequence.

ACC No: DQ192241

Dated: 2005-10-29 | Length: 1606 | CRC: -1914333702

                !!NA_SEQUENCE 1.0
ID   DQ192241   standard; genomic RNA; VRL; 1606 BP.
XX
AC   DQ192241;
XX
SV   DQ192241.1
XX
DT   29-OCT-2005 (Rel. 85, Created)
DT   29-OCT-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Operophtera brumata reovirus segment 7, complete sequence.
XX
KW   .
XX
OS   Operophtera brumata reovirus
OC   Viruses; dsRNA viruses; Reoviridae; unclassified Reoviridae.
XX
RN   [1]
RP   1-1606
RA   Graham R.I., Rao S., Possee R.D., Sait S.M., Mertens P.P.C., Hails R.S.;
RT   "Detection and characterization of three novel species of reovirus
RT   (Reoviridae), isolated from geographically separate populations of the
RT   winter moth Operophtera brumata (Lepidoptera: Geometridae) on Orkney";
RL   Unpublished.
XX
RN   [2]
RP   1-1606
RA   Graham R.I., Rao S., Possee R.D., Sait S.M., Mertens P.P.C., Hails R.S.;
RT   ;
RL   Submitted (04-SEP-2005) to the EMBL/GenBank/DDBJ databases.
RL   Molecular Biology, Institute for Animal Health, Ash Road, Pirbright,
RL   Woking, Surrey GU24 0NF, United Kingdom
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1606
FT                   /db_xref="taxon:352248"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Operophtera brumata reovirus"
FT                   /segment="7"
FT   CDS             18. .1517
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /protein_id="ABB17211.1"
FT                   /translation="MERLINSYRTISHSLRQLVPAYTTFEDLEAQLPPDYVFPESFQYP
FT                   PRIRYREIHSDAGFTREVEAAMAGRLANDEDNPIMFDYREPVRPGRIANWLTGYAEAAN
FT                   TLFDQVLSEVDALASVFYDVDELLRRRFQEGDVIPNDHDHPSNDVLEPSEHEAARVHSD
FT                   QVVEERVQRPLVRLESPGEDEIIFRGPSDIRYTPITLRTHFHFKTFERPVEKDQPYPSF
FT                   KVNQLHPNTGLDFSGRPISSSFISAFNMSINPELASVTSALVYLLNEGRYGVRDDSLVY
FT                   SHNTTHNQISPASTKAALKMEERVRDSVTYFSSKRLTRGQCEHLIRHMISYHINTPDTH
FT                   GLIVECYEQVGDLRADFTLESLRIPLLNVDWTRICYNISNALENELERAIFDVLMFVAI
FT                   MKFSVVVTEPQRMVDIAPGPFAVSAFLGCVPGSVVTHDAFKTEWKRTISRPNSSTEWPL
FT                   TKTSYHFPQAIGVPCTQVMPITRRPDFQMFGCLLSMVINNM"
XX
SQ   Sequence 1606 BP; 481 A; 329 C; 338 G; 458 T; 0 other;

DQ192241  Length: 1606  November 1, 2005 08:47  Type: N  Check: 8282  ..

       1  aaataaaatc tcggaacatg gagcgtctca ttaattcgta ccgaaccatc
      51  tcacactcac tgcgtcagtt agtcccagca tacactactt ttgaagatct
     101  cgaagcacaa ctaccgccag actatgtatt tccagaaagt tttcagtatc
     151  ccccgaggat tagatatcgt gaaattcact ctgatgcagg gtttacacgt
     201  gaagttgaag ctgcgatggc aggtagatta gcaaacgatg aggataaccc
     251  aatcatgttt gattaccgcg aaccagtacg accaggtaga atagcaaatt
     301  ggttaacagg ttacgccgaa gcagctaaca ccttattcga tcaagtatta
     351  tcagaagttg atgcactggc ttcagtattc tatgacgtcg acgaacttct
     401  acgccgccgc tttcaagaag gagatgtaat acccaacgat catgatcatc
     451  catcaaatga tgtacttgaa ccttctgagc atgaagcagc aagagtccat
     501  tcagatcagg ttgtagagga gcgtgtacaa cgtccactag ttcgattaga
     551  atcgccagga gaggatgaga ttatctttcg tggaccatcc gatatacgat
     601  ataccccaat aacacttcgt actcacttcc actttaaaac ctttgaacga
     651  cccgtcgaga aagatcaacc atatccctct tttaaggtta atcaattaca
     701  tccaaacact ggacttgact tctctggtag acctatttct tcatcattta
     751  tatctgcgtt caacatgtcc atcaaccccg agttggcttc ggtcacttcg
     801  gcgttggtgt accttttgaa tgagggccgg tacggggtgc gtgatgactc
     851  acttgtctat tcacataata caacacataa tcagatatcg ccagcttcaa
     901  cgaaagctgc attaaagatg gaggaacgtg tacgagattc agttacttat
     951  tttagttcaa aaagattaac gcgcggacaa tgtgagcatt tgatacgaca
    1001  tatgatcagt tatcatatta acacaccaga tacacatgga ttaattgttg
    1051  agtgctatga gcaggtcgga gatttaagag ctgactttac cttagagtca
    1101  ttacgtatac cattacttaa tgttgattgg acaaggatat gctataacat
    1151  ttctaatgca ttagagaatg agttagagcg tgcaattttt gatgttttaa
    1201  tgtttgttgc aataatgaag tttagtgtag ttgtgaccga acctcaacga
    1251  atggttgaca tagcaccagg tccatttgca gttagtgcgt ttttaggttg
    1301  tgtaccaggt tcagttgtta cgcatgatgc ttttaaaact gaatggaaga
    1351  ggaccatttc acggccaaat agtagtacag aatggccatt aactaaaaca
    1401  tcttatcact tcccccaagc tattggagtg ccatgtacac aggtgatgcc
    1451  aattacacga cgtccagact ttcaaatgtt cggatgttta ttatcaatgg
    1501  ttataaataa catgtaatat gtgaacggac gtggtgagaa atgagcgaac
    1551  ttacgtttaa tggatgactc tgtagctgtg ccttagcccc gagagagagg
    1601  taggtt