Sequence of DPV Operophtera brumata idnoreovirus

Operophtera brumata reovirus segment 10, complete sequence.

ACC No: DQ192244

Dated: 2005-10-29 | Length: 1509 | CRC: -1568624143

                !!NA_SEQUENCE 1.0
ID   DQ192244   standard; genomic RNA; VRL; 1509 BP.
XX
AC   DQ192244;
XX
SV   DQ192244.1
XX
DT   29-OCT-2005 (Rel. 85, Created)
DT   29-OCT-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Operophtera brumata reovirus segment 10, complete sequence.
XX
KW   .
XX
OS   Operophtera brumata reovirus
OC   Viruses; dsRNA viruses; Reoviridae; unclassified Reoviridae.
XX
RN   [1]
RP   1-1509
RA   Graham R.I., Rao S., Possee R.D., Sait S.M., Mertens P.P.C., Hails R.S.;
RT   "Detection and characterization of three novel species of reovirus
RT   (Reoviridae), isolated from geographically separate populations of the
RT   winter moth Operophtera brumata (Lepidoptera: Geometridae) on Orkney";
RL   Unpublished.
XX
RN   [2]
RP   1-1509
RA   Graham R.I., Rao S., Possee R.D., Sait S.M., Mertens P.P.C., Hails R.S.;
RT   ;
RL   Submitted (04-SEP-2005) to the EMBL/GenBank/DDBJ databases.
RL   Molecular Biology, Institute for Animal Health, Ash Road, Pirbright,
RL   Woking, Surrey GU24 0NF, United Kingdom
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1509
FT                   /db_xref="taxon:352248"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Operophtera brumata reovirus"
FT                   /segment="10"
FT   CDS             22. .1425
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /protein_id="ABB17214.1"
FT                   /translation="MSLIFKPGSISHTSSKTLHTTPHTKTLQDYVRPLLIVTTRSSLQM
FT                   DVVEYGLGYLLEAIRYGAIVLQEQEFQEFLSRTECERLPELFTVYLHVKSIDDIVRLVQ
FT                   SYGEFRTLTHEGHLTFKDISAHKVGPEAVRPPHAKTTSGRDLYRTFLQIFESLRPHTSK
FT                   TAHINKVIPERHDGGDHEFHTVEKREWIGLQPLNTATYTQPTATAPSLPPDPPTYRSES
FT                   VTPLPEFDLDHDRTPDNNSYQSYHGPNCDENVHPIIQPTFIECMRLCFCGIGYRGMNPH
FT                   EPGLTQSARVSTSAARLYGQTRLTLDEIIRRGYIPRNYIINKVSYAISNVNMRPKDDER
FT                   ARFLLTLLDKDHYIGMNLLTIGETIGEQLIVECLITVLRMQLFESSQYRKLPRSTVIRI
FT                   FVRGPKCSQCKFDELTKGEGSSWHFHALVLTNVSKSHVQSARRVMLNALSGMKRSYYIR
FT                   NDKIYHLKE"
XX
SQ   Sequence 1509 BP; 472 A; 315 C; 313 G; 409 T; 0 other;

DQ192244  Length: 1509  November 1, 2005 08:47  Type: N  Check: 7543  ..

       1  aaataaaacc caacggtaga aatgtcactc atattcaagc caggctccat
      51  ttcgcataca tcttccaaga ctctacatac aacaccacat actaaaacac
     101  tgcaggatta tgttcgaccc ttactcattg ttacgacgag atcgtcgctc
     151  caaatggatg tagttgaata cggattggga tacttactgg aagcaatacg
     201  atacggcgca atagtgttac aggaacagga atttcaagaa tttctatcaa
     251  gaacagagtg cgagcgccta ccagagttat ttacagtata cctacacgtt
     301  aagtcgattg atgatattgt ccggctagtt caatcatatg gtgagtttag
     351  aacattaaca catgagggtc atttaacatt taaagatatc agcgcacata
     401  aagttggtcc agaggcggtt agaccaccac atgcaaaaac gacatcaggt
     451  agggacttgt atcgaacctt tctgcaaatt tttgagtcat tgagaccaca
     501  tacgtcaaaa actgcacaca tcaataaagt gatcccagaa cgtcacgatg
     551  gtggagatca tgaatttcat acagttgaga aaagggaatg gataggatta
     601  cagccactta acaccgcaac ctatacgcaa ccaacagcta ccgctccaag
     651  cttgccaccg gatccaccaa cctaccgttc tgaaagtgtt actccattac
     701  cagagttcga ccttgaccat gatagaacgc ctgataacaa tagttatcag
     751  tcatatcatg gcccaaactg tgatgagaat gtacatccga tcattcaacc
     801  gacgttcatt gaatgcatga gattatgttt ttgtggtata ggatatagag
     851  gcatgaatcc acatgaaccg ggtttaactc agtcggcacg tgtatccaca
     901  tcagctgcac gattgtatgg ccagacgcga ctgacgcttg atgaaatcat
     951  tcgaagagga tatatcccac gaaattacat tatcaataaa gtttcctacg
    1001  ccatctcaaa tgtaaatatg cggcccaagg atgatgagag agcgcgtttc
    1051  ttattaactt tattggataa ggatcattat attggtatga atttactaac
    1101  tattggcgag acaattgggg aacaattaat agttgaatgt ctaatcacag
    1151  ttctacgcat gcagcttttt gagtcgagcc aatatcgtaa gctacctcgt
    1201  tcaaccgtca ttagaatttt tgttcgaggt cccaagtgct ctcaatgcaa
    1251  gtttgacgaa ctgacaaagg gagagggttc atcttggcat tttcatgccc
    1301  tagtacttac taatgtttca aagtcccatg tgcagtcagc tagacgtgtc
    1351  atgcttaatg ctctatcagg tatgaagaga agctattata ttcgaaatga
    1401  taagatttat cacttaaaag agtagagtgg ggatgcgcca tttggactac
    1451  ccgctgtgga tatgtactga cgtttagtac tcacaattcg gccagggttg
    1501  atggaggtt