Sequence of DPV Citrus tristeza virus

Citrus tristeza virus capsid protein mRNA, partial cds.

ACC No: DQ211658

Dated: 2006-10-02 | Length: 669 | CRC: 556257285

                
ID   DQ211658; SV 1; linear; mRNA; STD; VRL; 669 BP.
XX
AC   DQ211658;
XX
DT   02-OCT-2006 (Rel. 89, Created)
DT   02-OCT-2006 (Rel. 89, Last updated, Version 1)
XX
DE   Citrus tristeza virus capsid protein mRNA, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-669
RA   Amin H.A., Fonseca F., Carla S., Nolasco G.;
RT   "Typing of Egyptian Citrus tristeza virus (CTV) isolates based on the
RT   capsid protein gene";
RL   Unpublished.
XX
RN   [2]
RP   1-669
RA   Amin H.A., Fonseca F., Carla S., Nolasco G.;
RT   ;
RL   Submitted (19-SEP-2005) to the EMBL/GenBank/DDBJ databases.
RL   CDCTPV-FERN, University of Algarve, Campus de Gambelas, Faro 8005-139,
RL   Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .669
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="navel orange"
FT                   /isolate="AN0-1"
FT                   /mol_type="mRNA"
FT                   /country="Egypt:Anshas"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .>669
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /protein_id="ABB16908.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSANLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPSLSDKDKDFHIVMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 669 BP; 191 A; 120 C; 175 G; 183 T; 0 other;

dq211658 Length: 669  02-OCT-2006  Type: N  Check: 5369  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc gcgaatttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgggaacc
     151  caacagaacg ctgctttgaa cagagatttg tttcttactc tgaaagggaa
     201  gtatcctagc ttgtctgaca aggataagga cttccacata gttatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tgcaaagtga tgatgacacc
     301  acgggcataa catatactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  atgcccttcg agtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt acctatgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa ggaacaatta
     601  ttaaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgt