Sequence of DPV Angelonia flower break virus

Angelonia flower break virus, complete genome.

ACC No: DQ219415

Dated: 2007-01-31 | Length: 3964 | CRC: -321823508

                
ID   DQ219415; SV 1; linear; genomic RNA; STD; VRL; 3964 BP.
XX
AC   DQ219415;
XX
DT   17-DEC-2005 (Rel. 86, Created)
DT   31-JAN-2007 (Rel. 90, Last updated, Version 2)
XX
DE   Angelonia flower break virus, complete genome.
XX
KW   .
XX
OS   Angelonia flower break virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-3964
RA   Adkins S., Hammond J., Maroon-Lango C.J., Harness A., Kulemeka B.,
RA   Geister R., Bandla M., Spiegel S., Gera A.;
RT   "Characterization of a carmovirus from Angelonia";
RL   Phytopathology 95:S2-S2(2005).
XX
RN   [2]
RP   1-3964
RA   Adkins S., Hammond J., Gera A., Maroon-Lango C.J., Sobolev I., Harness A.,
RA   Zeidan M., Spiegal S.;
RT   "Biological and Molecular Characterization of a Novel Carmovirus Isolated
RT   from Angelonia";
RL   Phytopathology 96:460-467(2006).
XX
RN   [3]
RP   1-3964
RA   Adkins S., Vanderspool M.C.;
RT   ;
RL   Submitted (21-SEP-2005) to the EMBL/GenBank/DDBJ databases.
RL   Agricultural Research Service, United States Horticultural Research
RL   Laboratory, 2001 South Rock Road, Fort Pierce, FL 34945, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3964
FT                   /organism="Angelonia flower break virus"
FT                   /specific_host="Angelonia angustifolia"
FT                   /isolate="Florida"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /virion
FT                   /db_xref="taxon:352882"
FT   5'UTR           1. .24
FT   gene            25. .2349
FT                   /gene="p88"
FT   CDS             25. .2349
FT                   /codon_start=1
FT                   /transl_except=(pos:757. .759,aa:Tyr)
FT                   /transl_except=(pos:2305. .2307,aa:Tyr)
FT                   /gene="p88"
FT                   /product="p88"
FT                   /note="putative replicase-associated protein; contains two
FT                   readthrough stop codons"
FT                   /db_xref="GOA:Q2Q475"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Q475"
FT                   /protein_id="ABB29867.1"
FT                   /translation="MGFFRDVLKCGAQNAIGCTLITGAVAVGIAALEVRAAIGAYEFTN
FT                   YALHTSIDYIRTRGESLQPVPQYPSDNTSEAFGVDLVSEESNLSDHLDTIPEETDGSKV
FT                   VRPARAIIRRHARGKFSYCLAMAAKNAFGGTPTNTKANQMSVMRFMVGKCGEHHLTDAS
FT                   ARVACAEAMSVCFTPDISEINMFKGLNSHAAYLRTAALREAKRVDCWWYNLLLHPLAAN
FT                   AWQRAWMVLNRLGDLEAFEFIKYGRIFQLEGVDTKIRRGSHPLMVELEKPIPPKCRKLF
FT                   GITGLHTNIEYRLHNHSFNNLRRGLMERVYFVENKSTKTLSPCPEPEVGAFTALKKWRR
FT                   RFSSIVGQHPRISAEEFVDCYHGRKKTIYANAAASLQQKPLQRNDARLKTFTKAEKFNF
FT                   TAKPDPAPRVIQPREPRYNVELGRYLKRFEHHAYRALDKIWGGPTVMKGYNVEDVAKNI
FT                   LAAWDQFRRPVAIGFDMSRFDQHVSVPALQFEHSCYLSCFGNDPYLAQLLSWQIDNFGI
FT                   GFANNGLIRYKKRGCRMSGDMNTALGNCLLACIITKEIVKDIKARLINNGDDCVLIVEQ
FT                   KDLDFVVSNLTTGWSRFGFTCIAEEPVFEPEKIRFCQMAPIFDGETWLMVRDPDYSLSK
FT                   DCYSLVHWNSKKNCQMWMKCVGEGGIALTGGVPVVQEFYKLYLRESEGVKVSQGLAEHC
FT                   AAGIYGMVNGSKRTYRPPTPEARFSFYKAFGMPPDYQEALEEFYRNEILDLEWVVPGKD
FT                   LTTFKWTYKSKRLTTDLGKRL"
FT   gene            25. .2307
FT                   /gene="p86"
FT   CDS             25. .2307
FT                   /codon_start=1
FT                   /transl_except=(pos:757. .759,aa:Tyr)
FT                   /gene="p86"
FT                   /product="p86"
FT                   /note="putative RNA-dependent RNA polymerase; contains read
FT                   through stop codon"
FT                   /db_xref="GOA:Q2Q474"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Q474"
FT                   /protein_id="ABB29868.1"
FT                   /translation="MGFFRDVLKCGAQNAIGCTLITGAVAVGIAALEVRAAIGAYEFTN
FT                   YALHTSIDYIRTRGESLQPVPQYPSDNTSEAFGVDLVSEESNLSDHLDTIPEETDGSKV
FT                   VRPARAIIRRHARGKFSYCLAMAAKNAFGGTPTNTKANQMSVMRFMVGKCGEHHLTDAS
FT                   ARVACAEAMSVCFTPDISEINMFKGLNSHAAYLRTAALREAKRVDCWWYNLLLHPLAAN
FT                   AWQRAWMVLNRLGDLEAFEFIKYGRIFQLEGVDTKIRRGSHPLMVELEKPIPPKCRKLF
FT                   GITGLHTNIEYRLHNHSFNNLRRGLMERVYFVENKSTKTLSPCPEPEVGAFTALKKWRR
FT                   RFSSIVGQHPRISAEEFVDCYHGRKKTIYANAAASLQQKPLQRNDARLKTFTKAEKFNF
FT                   TAKPDPAPRVIQPREPRYNVELGRYLKRFEHHAYRALDKIWGGPTVMKGYNVEDVAKNI
FT                   LAAWDQFRRPVAIGFDMSRFDQHVSVPALQFEHSCYLSCFGNDPYLAQLLSWQIDNFGI
FT                   GFANNGLIRYKKRGCRMSGDMNTALGNCLLACIITKEIVKDIKARLINNGDDCVLIVEQ
FT                   KDLDFVVSNLTTGWSRFGFTCIAEEPVFEPEKIRFCQMAPIFDGETWLMVRDPDYSLSK
FT                   DCYSLVHWNSKKNCQMWMKCVGEGGIALTGGVPVVQEFYKLYLRESEGVKVSQGLAEHC
FT                   AAGIYGMVNGSKRTYRPPTPEARFSFYKAFGMPPDYQEALEEFYRNEILDLEWVVPGKD
FT                   LTTFKWT"
FT   gene            25. .759
FT                   /gene="p27"
FT   CDS             25. .759
FT                   /codon_start=1
FT                   /gene="p27"
FT                   /product="p27"
FT                   /note="putative replicase-associated protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Q473"
FT                   /protein_id="ABB29869.1"
FT                   /translation="MGFFRDVLKCGAQNAIGCTLITGAVAVGIAALEVRAAIGAYEFTN
FT                   YALHTSIDYIRTRGESLQPVPQYPSDNTSEAFGVDLVSEESNLSDHLDTIPEETDGSKV
FT                   VRPARAIIRRHARGKFSYCLAMAAKNAFGGTPTNTKANQMSVMRFMVGKCGEHHLTDAS
FT                   ARVACAEAMSVCFTPDISEINMFKGLNSHAAYLRTAALREAKRVDCWWYNLLLHPLAAN
FT                   AWQRAWMVLNRLGDLEAFEFIK"
FT   gene            2298. .2483
FT                   /gene="p7"
FT   CDS             2298. .2483
FT                   /codon_start=1
FT                   /gene="p7"
FT                   /product="p7"
FT                   /note="putative movement protein"
FT                   /db_xref="GOA:Q2Q472"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Q472"
FT                   /protein_id="ABB29870.1"
FT                   /translation="MDIEIKEIDNRSGKTVVNRGKTKAKKSIAKDAIRKPQSDSSIGGN
FT                   WVVVADTVNFEFTINL"
FT   gene            2389. .2655
FT                   /gene="p10"
FT   CDS             2389. .2655
FT                   /codon_start=1
FT                   /gene="p10"
FT                   /product="p10"
FT                   /note="putative movement protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Q471"
FT                   /protein_id="ABB29871.1"
FT                   /translation="MLSANLNLTVLSGVIGLLLLTRSTLNLPSIYDLVPFSLPRLVKLD
FT                   QIIAFAFLGLLLNLLNCSQTVISHRYSNDNSKTQYVTISTPSR"
FT   gene            2652. .3707
FT                   /gene="CP"
FT   CDS             2652. .3707
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q2Q470"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Q470"
FT                   /protein_id="ABB29872.1"
FT                   /translation="MSNLRNDPRVAKLAAQGSAWAKRLMNNGWGGLRPNQKAAARQALG
FT                   ILPAPVATPVTTTRLVNGNPTNQRRKRNQPGNLRTDTPVTSTEFFADVLLHTGEDANIR
FT                   SWVINPREVSLFPRLSIQSALYDKYRISSLRVRFASSCSFEVNGKIMLGFIGDSSDEVP
FT                   VTKIDVHSLTKTAECTAMQNIIFNVGGDNITRFLGDRASDDPKLVNFGRIVLCTYGFDS
FT                   NAPSIVGELSVEYTITLLNPSPVASLSQRWISGSSKGIGFVEYTHDVATKTYQFDFQTG
FT                   GRYCLIVATDKGVFGSPLVTGSVQTQSRVVTDGTATLMTVSVDMKAPNGTISWIPPTDQ
FT                   GALTEWIVTRV"
FT   3'UTR           3708. .3964
XX
SQ   Sequence 3964 BP; 1056 A; 981 C; 990 G; 937 T; 0 other;

dq219415 Length: 3964  31-JAN-2007  Type: N  Check: 2102  ..

       1  gggtaagctt gatcaactta caccatgggg ttctttcgcg atgtactcaa
      51  atgcggcgca caaaatgcaa tcggttgcac cctgatcaca ggggccgttg
     101  cggttggcat cgcagcgctt gaagtgagag cagctatagg tgcttatgag
     151  ttcactaatt acgctttaca cactagtatt gattacatac ggactagggg
     201  ggaatctcta cagcccgtcc cacagtatcc ttccgacaac accagtgagg
     251  cgttcggtgt tgatcttgtt tcggaggaga gcaatctcag cgaccatctt
     301  gacaccattc ctgaggaaac agatggcagc aaggttgtgc gaccagcccg
     351  agcgataatt cgccgccatg cccgtggaaa attttcctat tgtttagcaa
     401  tggctgcgaa aaatgcattt ggaggcactc caactaacac caaggccaat
     451  caaatgagtg tgatgaggtt catggttgga aagtgcgggg agcatcatct
     501  cactgatgct agtgccaggg tcgcgtgcgc tgaagcaatg tctgtgtgct
     551  tcaccccaga tatttcagag ataaacatgt ttaaggggtt gaattcacat
     601  gcagcatacc ttaggacggc tgcgctgaga gaggccaaac gagtggactg
     651  ttggtggtac aacctgctcc tgcacccgct cgcggcaaac gcttggcaac
     701  gggcttggat ggttctgaat cgcctcggcg atttggaagc atttgagttc
     751  atcaaatagg gacgtatatt ccagctcgag ggtgtggata caaagatccg
     801  gagggggtcc caccctttaa tggttgagct ggaaaaaccc atacccccaa
     851  agtgcagaaa attgttcggc atcacaggac tacacactaa cattgagtac
     901  cggctccaca atcatagttt caacaacttg agacggggct tgatggaaag
     951  ggtgtatttt gtcgaaaaca agagtacgaa gactctttcc ccatgtcctg
    1001  agcctgaagt gggagctttc actgctctca agaaatggag gcgacgcttt
    1051  agcagtattg ttgggcagca tcccaggatc tccgcagagg aatttgtgga
    1101  ttgttatcat ggaaggaaga agacaatata cgctaatgcc gctgcatcct
    1151  tacagcagaa accacttcag cgaaatgacg ccagattgaa aacgtttacc
    1201  aaagcggaga aatttaattt tacggcaaaa cctgacccag caccaagagt
    1251  gattcagccg agagaaccaa gatacaacgt ggagcttgga cggtatttaa
    1301  aacgatttga gcatcacgcc tacagggcac tcgacaagat ctggggagga
    1351  cctaccgtta tgaaaggtta taacgtggaa gatgtcgcaa agaacatcct
    1401  ggcagcgtgg gaccaattcc gtagaccagt ggccattggc tttgatatga
    1451  gccgatttga tcaacacgtc tccgtgccag cgctccaatt tgagcactca
    1501  tgctacctat cctgtttcgg caatgaccca tatttggccc agctactcag
    1551  ctggcaaatt gacaattttg gcatcgggtt tgcaaacaat ggactaatac
    1601  gctacaagaa gagaggctgt agaatgagcg gggacatgaa caccgctctg
    1651  ggaaactgct tgttagcttg cattatcacc aaagagattg ttaaggacat
    1701  aaaggcaaga ctgataaaca atggggatga ctgcgtgctc attgttgaac
    1751  aaaaagacct ggatttcgtc gtgagtaatt taacgacggg ttggtccagg
    1801  tttggattca cctgcattgc agaggagcca gtctttgagc ccgagaagat
    1851  cagattctgt cagatggccc caatttttga tggtgaaact tggcttatgg
    1901  tgcgtgaccc ggattacagt ctcagcaaag attgttacag cttagttcat
    1951  tggaacagca agaaaaattg tcaaatgtgg atgaaatgtg tcggagaagg
    2001  aggtatcgcg ctcacaggcg gggtgccagt tgtccaggag ttctataagt
    2051  tgtatctgag agaaagtgaa ggtgtgaagg tcagtcaagg actagccgaa
    2101  cattgtgccg ctggcatcta cggcatggtg aacggctcaa agcgaacata
    2151  tcgaccaccc accccagagg ctcggtttag tttctacaag gcattcggaa
    2201  tgccccctga ttaccaggaa gctctcgaag agttctatag aaacgaaatc
    2251  cttgacttag agtgggtggt gcctggaaaa gacctaacca ccttcaaatg
    2301  gacatagaaa tcaaagagat tgacaacaga tctgggaaaa cggttgtgaa
    2351  tagaggcaag acgaaggcaa agaagagcat agccaaagat gctatccgca
    2401  aacctcaatc tgacagttct atcgggggta attgggttgt tgttgctgac
    2451  acggtcaact ttgaatttac catcaattta tgacttggtg cctttcagct
    2501  taccccgctt ggtaaaactt gaccagatta tcgcttttgc attcctcgga
    2551  cttttattga acctgcttaa ctgctcccag actgttattt cccaccgcta
    2601  ctcaaacgac aacagcaaga cacagtacgt aaccatcagc actccatcac
    2651  gatgagcaat ctccgcaacg acccgcgagt cgcaaagctt gctgcccaag
    2701  gctccgcctg ggccaaacga ctcatgaaca atggttgggg tgggcttcgg
    2751  ccgaatcaga aagctgcagc acggcaagca ctggggatcc tccccgctcc
    2801  tgttgccact cccgtgacca ccaccaggtt agtcaacggt aaccctacca
    2851  accagaggcg taaacgcaat cagcctggca atctgcgtac tgatacgcca
    2901  gtcaccagta ctgaattctt cgccgacgtg ctgttacaca ctggagaaga
    2951  cgcaaacatc cgctcttggg tcatcaaccc ccgagaggtc agcctcttcc
    3001  ctcggctctc tatccaatcc gcgctgtacg acaagtaccg catatcatct
    3051  ctccgagttc gtttcgcttc ctcttgttcg tttgaagtga acgggaagat
    3101  catgctcggg ttcattggag actcctctga tgaggtaccc gtcacaaaga
    3151  tcgacgttca ctccctcact aagacagcag agtgcactgc tatgcagaac
    3201  atcattttta acgtgggagg agacaacatc acccgctttc tcggcgacag
    3251  agcaagcgac gacccgaagc ttgtcaactt tggccgtatc gtgctctgca
    3301  cttacggctt tgacagcaat gcaccatcca ttgtcggaga gttgtctgtc
    3351  gagtacacca tcaccctact caatccatcc cctgttgcta gtctgtctca
    3401  aaggtggatc agcggcagct ccaaaggaat agggtttgtc gagtacacac
    3451  atgatgtcgc aacaaagacg taccaattcg acttccaaac aggagggcgg
    3501  tattgtctta ttgtcgccac ggacaaaggg gtctttggat ctcctcttgt
    3551  aacagggtca gttcaaacgc agtcacgtgt ggtgactgac ggaaccgcca
    3601  cactcatgac ggtgtccgta gatatgaaag ctcctaatgg caccatcagt
    3651  tggattccgc caacagatca aggtgcactc actgagtgga ttgtcactcg
    3701  ggtataacgg ctggtcaccg tacctcccag tccgatagcg cttccggtca
    3751  acgactcttc cctagctccc ggcacttctc tttccggcac atgctaagga
    3801  cgttgatcgg actcacgtgt atagggccgg agggataccc ttgcgtcttc
    3851  aatcacactc tcgttacctg cgtgaaccta aaatccttcg ggtgggctgg
    3901  aacacgctcc aagtttcctt gtgaaagaaa gtgtagaact tccattaaag
    3951  tttctacacg ccaa