Sequence of DPV Angelonia flower break virus

Angelonia flower break virus isolate AnFBV-IL coat protein gene, complete cds.

ACC No: DQ223771

Dated: 2007-01-31 | Length: 1433 | CRC: -1117200732

                
ID   DQ223771; SV 1; linear; genomic RNA; STD; VRL; 1433 BP.
XX
AC   DQ223771;
XX
DT   07-MAR-2006 (Rel. 87, Created)
DT   31-JAN-2007 (Rel. 90, Last updated, Version 2)
XX
DE   Angelonia flower break virus isolate AnFBV-IL coat protein gene, complete
DE   cds.
XX
KW   .
XX
OS   Angelonia flower break virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1433
RA   Adkins S., Hammond J., Gera A., Maroon-Lango C.J., Sobolev I., Harness A.,
RA   Zeidan M., Spiegal S.;
RT   "Biological and Molecular Characterization of a Novel Carmovirus Isolated
RT   from Angelonia";
RL   Phytopathology 96:460-467(2006).
XX
RN   [2]
RP   1-1433
RA   Adkins S., Hammond J., Gera A., Maroon-Lango C.J., Harness A., Sobolev I.,
RA   Zeidan M., Spiegel S.;
RT   "Biological and Molecular Characterization of a Novel Carmovirus Isolated
RT   from Angelonia";
RL   Unpublished.
XX
RN   [3]
RP   1-1433
RA   Gera A., Adkins S., Hammond J., Maroon-Lango C.J., Sobolev I., Harness A.,
RA   Zeidan M., Spiegel S.;
RT   ;
RL   Submitted (27-SEP-2005) to the EMBL/GenBank/DDBJ databases.
RL   Virology, A.R.O., Bet-Dagan 50250, Israel
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1433
FT                   /organism="Angelonia flower break virus"
FT                   /specific_host="Angelonia angustifolia with flower break
FT                   and mild foliar symptoms"
FT                   /isolate="AnFBV-IL"
FT                   /mol_type="genomic RNA"
FT                   /country="Israel"
FT                   /virion
FT                   /db_xref="taxon:352882"
FT   CDS             149. .1204
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="CP"
FT                   /db_xref="GOA:Q283N6"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q283N6"
FT                   /protein_id="ABB52387.1"
FT                   /translation="MSNLRNDPRVAKLAAQGSAWAKRLMNNGWGGLRPNQKAAARQALG
FT                   ILPAPVATPVTTTRLVNGNPTNQRRKRNQPGNLRTDTPVTSTEFFADVLLHTGEDANIR
FT                   SWVINPREVSLFPRLSIQSALYDKYRISSLRVRFASSCSFEVNGKTMLGFIGDSSDEVP
FT                   VTKIDVHSLTKTAECTAMQNIIFNMGGDNITRFLGDRASDDPKLVNFGRIVLCTYGFDS
FT                   NAPSIVGELSVEYTITLLNPSPVASLSQRWISGSSKGIGFVGYTHDVATKTYQFAFQTG
FT                   GRYCLIVATDKGVFGSPLVTGSVQTQSRVVTDGTATLMTVSVDMKAPNGTISWIPPTDQ
FT                   GALTEWIVTRV"
FT   3'UTR           1205. .1433
XX
SQ   Sequence 1433 BP; 343 A; 427 C; 332 G; 331 T; 0 other;

dq223771 Length: 1433  31-JAN-2007  Type: N  Check: 915  ..

       1  cccacttggt aaaacttgac cagattatcg cttttgcatt cctcggactt
      51  ttattgaacc tgcttaactg ctcccagact gttatttccc accgctactc
     101  aaacgacaac agcaagacac agtacgtaac catcagcact ccatcacgat
     151  gagcaatctc cgcaacgacc cgcgggtcgc aaagcttgct gcccaaggct
     201  cagcctgggc caaacgactc atgaacaatg gttggggtgg gcttcggccg
     251  aatcagaaag ctgcagcacg gcaagcactg ggaatcctcc ccgctcctgt
     301  tgccactccc gtgaccacca ccaggttagt caacggtaac cccaccaacc
     351  agaggcgtaa acgcaatcag cctggcaatc tgcgtactga tacgccagtc
     401  accagtactg aattcttcgc cgacgtactg ttacacactg gagaagacgc
     451  aaacatccgc tcttgggtca tcaacccccg agaggtcagc ctcttccctc
     501  ggctctctat ccaatccgcg ctgtacgaca agtaccgcat atcatctctc
     551  cgagttcgtt tcgcttcctc ctgttcgttt gaagtgaacg ggaagaccat
     601  gctcgggttc attggagact cctctgatga ggtacccgtc acaaagatcg
     651  acgttcactc cctcactaag acagcagagt gtactgctat gcagaacatc
     701  atctttaaca tgggaggaga caacatcacc cgctttctcg gtgacagagc
     751  aagcgacgac ccgaagcttg tcaactttgg ccgcatcgtg ctctgcactt
     801  acggctttga cagcaatgca ccatccattg tcggagagtt gtctgtcgag
     851  tacaccatca ccctactcaa tccatcccct gttgctagtc tgtctcaaag
     901  gtggatcagc ggcagctcca aaggaatagg gtttgtgggg tacacacatg
     951  atgtcgcaac aaagacttac caattcgcct tccaaacagg aggacggtat
    1001  tgtcttattg tcgccacgga caaaggggtc tttggatctc ctcttgtaac
    1051  agggtcagtc caaacgcagt cacgtgtggt gactgacgga accgccacgc
    1101  tcatgacggt gtccgtagat atgaaagctc ctaatggcac catcagttgg
    1151  attccgccaa cagatcaagg tgcactcact gagtggattg tcactcgggt
    1201  ataacggctg gtcaccgtac ctcccagtcc gatagcgctc ccggtcaacg
    1251  actcttccct agctcccggc acttctcttt tccggcacat gctaaggacg
    1301  ttgatcggac tcacgtgtat agggccggag ggatatcctt gcgtcttcaa
    1351  tcacactctc gttacctgcg tggacctaaa atccttcggg tgggctggaa
    1401  cacgctccca gtttccttgg gaaagaaagt gta