Sequence of DPV Wuhan nodavirus

Wuhan nodavirus capsid precursor protein gene, complete cds.

ACC No: DQ233638

Dated: 2006-07-14 | Length: 1562 | CRC: -238190074

                
ID   DQ233638; SV 1; linear; genomic RNA; STD; VRL; 1562 BP.
XX
AC   DQ233638;
XX
DT   14-JUL-2006 (Rel. 88, Created)
DT   14-JUL-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Wuhan nodavirus capsid precursor protein gene, complete cds.
XX
KW   .
XX
OS   Wuhan nodavirus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Nodaviridae;
OC   Betanodavirus.
XX
RN   [1]
RP   1-1562
RX   DOI; 10.1016/j.virusres.2006.03.011.
RX   PUBMED; 16644053.
RA   Liu C., Zhang J., Wang J., Lu J., Chen W., Cai D., Hu Y.;
RT   "Sequence analysis of coat protein gene of Wuhan nodavirus isolated from
RT   insect";
RL   Virus Res. 121(1):17-22(2006).
XX
RN   [2]
RP   1-1562
RA   Liu C., Zhang J., Hu Y.;
RT   ;
RL   Submitted (07-OCT-2005) to the EMBL/GenBank/DDBJ databases.
RL   Virology, Life Science, Luojiashan, Wuhan, Hubei 430072, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1562
FT                   /organism="Wuhan nodavirus"
FT                   /host="Pieris rapae"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /db_xref="taxon:356127"
FT   CDS             108. .1310
FT                   /codon_start=1
FT                   /product="capsid precursor protein"
FT                   /note="structural protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q0QVT6"
FT                   /protein_id="ABB71128.1"
FT                   /translation="MAKKQPRKSVRIAPRMRVSTIPASVNTASRLRSVQTKQLNLYSNT
FT                   DRLYHVTLPANTAKGTVIYDQIITPAIGRRLRQQAALFQKIKNNSLRFEVQTQTPTTNG
FT                   GGYVVAFLHDPSMDVGQGENALKALTAVQGTQTSKFWQSVNMNVQTTKQQDFTLNGSDV
FT                   RLFSPGRFVVLTDGAPTEPVSITILFHWTVELSRPALQRPLNQLAQAVLVATELYQEGL
FT                   YLRYSNWDGTNFSPPKGQNNETALHMENAFAGLPPISSFGTNTLFYQLPYPLRVTGNEV
FT                   LAQFIGFSVSGGNLRAAPYQLPGTQYALTSTSTTAQSFQFMVQGVRLTPVMPDEFYGTT
FT                   QGAFLSENIQSVSHNLLPTICRNFQQMKLTGSSTPSDKKQDLQDRLSSMRDRFWDPQNM
FT                   P"
XX
SQ   Sequence 1562 BP; 459 A; 405 C; 301 G; 397 T; 0 other;

dq233638 Length: 1562  14-JUL-2006  Type: N  Check: 8215  ..

       1  ataaaacctt acaaattatg tcaaaattaa tcaatatttt agacagcttg
      51  ttatccacta ataaatctaa taagatgtca cgtggtatac gtaaatcaaa
     101  acgcaagatg gcaaagaagc agcctcgcaa gtcagtgcgt atcgcacccc
     151  gcatgcgagt atcaactata cctgcttctg taaatactgc tagccggcta
     201  cggtcggtgc agaccaaaca gttaaatctg tatagtaata ctgatcgtct
     251  ctatcatgtc acccttcccg ccaatacagc gaagggtaca gttatctacg
     301  atcagataat aacacccgcc atcggtagaa gattacgtca acaggctgca
     351  ctttttcaga aaataaagaa taattcactc cgcttcgagg tccagaccca
     401  aacaccaact acaaatggtg gtggttacgt agttgctttt ctacatgatc
     451  catccatgga tgtcgggcag ggtgaaaatg ctcttaaagc tctgacagca
     501  gtgcaaggca ctcagacctc aaaattctgg cagtcagtca atatgaacgt
     551  ccaaacaaca aaacaacagg actttacctt gaacggaagt gatgttcgtc
     601  tattttcacc aggacgtttc gtcgttttga cagacggtgc accaactgag
     651  cccgtctcta taaccatatt gttccactgg actgtcgagt tgtcccgccc
     701  tgcactacaa cgtccgctca accaattagc ccaagcagtg ctcgtagcca
     751  cagagttata tcaagaaggc ctttatctcc gctattccaa ctgggatggt
     801  accaacttct cccctccgaa aggtcaaaac aatgaaacag cattgcacat
     851  ggaaaacgca tttgctgggc taccgcctat atcttccttt ggcaccaata
     901  ccctgtttta tcaattacca tacccattaa gagttacggg aaacgaggta
     951  ttagctcaat tcattggatt tagcgttagt ggaggcaatt tacgggcagc
    1001  accctaccaa ttacctggta cgcaatatgc tctgacttct acctcaacca
    1051  ctgcacaatc cttccagttt atggtgcaag gagtaagatt gacccctgtt
    1101  atgcctgatg aattttatgg tacgacacag ggtgcttttt tatccgagaa
    1151  tatccagtca gtttctcaca atctgctgcc gaccatctgc agaaactttc
    1201  aacaaatgaa actgacaggc tcctcgacac catcagacaa gaagcaggac
    1251  ttacaagaca ggctatcatc gatgagggac cgtttctggg acccacagaa
    1301  tatgccttag gcgtacaaga agtagtagcc gctgtaggat ctgtagatgc
    1351  gactttatta tctctagatg cgactgttgc aacctcagcc acagcaataa
    1401  ccgcagccat agctgccggc actacagcca taaccacagc aattgtatcg
    1451  gaaaacaaga acaccgcgac attgctacaa tcggtacttg gctacttgcg
    1501  ccttttctct gttcctgcct ctaatggcac tactatcctc ttttacccga
    1551  ccacatcaac at