Sequence of DPV Lettuce necrotic stunt virus

Lettuce necrotic stunt virus isolate L2 P22 (P22) gene, complete cds.

ACC No: DQ238848

Dated: 2006-01-01 | Length: 570 | CRC: 191955676

                
ID   DQ238848   standard; genomic RNA; VRL; 570 BP.
XX
AC   DQ238848;
XX
SV   DQ238848.1
XX
DT   01-JAN-2006 (Rel. 86, Created)
DT   01-JAN-2006 (Rel. 86, Last updated, Version 1)
XX
DE   Lettuce necrotic stunt virus isolate L2 P22 (P22) gene, complete cds.
XX
KW   .
XX
OS   Lettuce necrotic stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-570
RA   Schoelz J.E., Wiggins B.E., Wintermantel W.M., Ross K.;
RT   "Introgression of a tombusvirus resistance locus from N. edwardsonii var.
RT   Columbia to to N. clevelandii";
RL   Unpublished.
XX
RN   [2]
RP   1-570
RA   Wintermantel W.M., Anchieta A.G.;
RT   "Complete sequence of the tombusvirus, Lettuce necrotic stunt virus";
RL   Unpublished.
XX
RN   [3]
RP   1-570
RA   Wintermantel W.M., Anchieta A.G.;
RT   ;
RL   Submitted (12-OCT-2005) to the EMBL/GenBank/DDBJ databases.
RL   Virology, USDA-ARS, 1636 E. Alisal Street, Salinas, CA 93905, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .570
FT                   /country="USA:Salinas, CA"
FT                   /db_xref="taxon:167947"
FT                   /mol_type="genomic RNA"
FT                   /organism="Lettuce necrotic stunt virus"
FT                   /isolate="L2"
FT   gene            1. .570
FT                   /gene="P22"
FT   CDS             1. .570
FT                   /codon_start=1
FT                   /note="putative cell-to-cell movement protein"
FT                   /gene="P22"
FT                   /product="P22"
FT                   /protein_id="ABB71100.1"
FT                   /translation="MDTEYEQVNKPWNELYKETTLGNKLTVNVGMEDQEVALLPSNFLT
FT                   KVRVGLSGGYITMRRIRIRITPLVSRKAGVSGKLYLRDISDTTGRKLHCTESLDLGREI
FT                   RLTMQHLDFSVSTRSDVPIVFGFEELVSPFLEGRELFSISVRWQFGLSKNCYSLPQSKW
FT                   KVMYQEDALKVLKPSKKKASKTDSSV"
XX
SQ   Sequence 570 BP; 173 A; 107 C; 151 G; 139 T; 0 other;

dq238848 Length: 570  01-JAN-2006  Type: N  Check: 2771  ..

       1  atggatactg aatacgaaca agtcaataaa ccatggaacg agctatacaa
      51  ggaaacgacg ctagggaaca agctaacagt gaacgttgga atggaggatc
     101  aggaggtagc acttctccct tcaaattttc tgacgaaagt ccgagttgga
     151  ctgagtggag gctacataac gatgagacga attcgaatca ggataacccc
     201  cttggtttca aggaaagctg gggtttcggg aaagttgtat ttaagagata
     251  tctcagatac gacgggacgg aagcttcatt gcacagagtc cttggatctt
     301  ggacgggaga ttcggttaac tatgcagcat ctcgattttt cggtatcaac
     351  cagatcggat gtacctatag tattcggttt cgaggagtta gtgtcaccat
     401  ttctggaggg tcgagaactc ttcagcatct ctgtgagatg gcagttcggg
     451  ctaagcaaga attgctacag cttaccccag tcgaagtgga aagtgatgta
     501  tcaagaagat gccctgaagg ttttaaaacc ttcgaagaag aaagcgagta
     551  agacagactc ttcagtctga