Sequence of DPV Citrus tristeza virus

Citrus tristeza virus from Mexico, complete genome.

ACC No: DQ272579

Dated: 2005-11-14 | Length: 19300 | CRC: 835170401

                
ID   DQ272579   standard; genomic RNA; VRL; 19300 BP.
XX
AC   DQ272579;
XX
SV   DQ272579.1
XX
DT   14-NOV-2005 (Rel. 85, Created)
DT   14-NOV-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Citrus tristeza virus from Mexico, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19300
RA   Quiroz J.D.C., Mendoza A., Cruz M.A., Fernandez S., Pena A.;
RT   "The Complete RNA genome sequence of Citrus Tristeza Virus from Mexico";
RL   Unpublished.
XX
RN   [2]
RP   1-19300
RA   Quiroz J.D.C., Mendoza A., Cruz M.A., Fernandez S., Pena A.;
RT   ;
RL   Submitted (01-NOV-2005) to the EMBL/GenBank/DDBJ databases.
RL   Centro de Biotecnologia Genomica, Instituto Politecnico Nacional, Blvd. del
RL   Maestro SN, Reynosa, Tamaulipas 88710, Mexico
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19300
FT                   /country="Mexico"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /note="causes stem pitting and quick tree decline"
FT                   /organism="Citrus tristeza virus"
FT                   /serotype="Severe"
FT                   /isolate="CTV"
FT   5'UTR           1. .107
FT                   /note="approximately the same size as the respective UTRs
FT                   of other closteroviruses"
FT   gene            108. .9482
FT                   /gene="p353"
FT   CDS             108. .9482
FT                   /codon_start=1
FT                   /note="353 kDa viral polyprotein; contains domains for two
FT                   papain-like leader proteases, a methyltransferase, and a
FT                   helicase"
FT                   /gene="p353"
FT                   /function="replication"
FT                   /product="p353"
FT                   /protein_id="ABB59451.1"
FT                   /translation="MSKLRGSFWSSAIAVNSDYTISRIWRKLNTIESCTTLVLLESPRW
FT                   FVTNRLICRSSLYGNLYFRFLFARLSRNSCCWASSCRSAFRVPLWPSRYQRIWRCSSPL
FT                   CFAGFSRFSLCKPPLTSAAKRSLRQAKRESVSLSSRASSRFSREVPRGTRSRLHRRVVR
FT                   RADTAPVESPQDKPTRRNSRLGKTSHLPYVGEAALDDILRWIEEVNPHPSMVAIPVPIT
FT                   FGTMPATAWCSHSEAAVLRAALTITRLKLISPLRRNTYGTSIMTYLLPLTVPVRFLPAS
FT                   ASIFPSKSKLGVEVPSGRDLHTAFVRSSHASAFFSDAVRASFVPSSAEQFFHFRRQRTH
FT                   VLAITDPVLCGTVSVLMSDGVNTARLDVVAPAYYAYAESLGARVRFLWESSDVDDAKVR
FT                   DGQCYVRHVFDVALYFGRRADLSVRRALGMYPTVGALKAYLVREYGRDSLKVPMRGTYT
FT                   FGSVFHCLSLNLQVDLRSIPNHHLVGGTSAHVLIGQVRVSVPGSIVKPSRSAVRRRNRR
FT                   MRRDGFLGSSGSSSSAGESTRCSDCSSPRGLPSPSVLKPSLGRIPSIDRRFRFPAGTQL
FT                   RVSVPRRVDDHVYVSTGSNFDELCHAVLTRMSKGTTLEIHLHSIREGKGLLGLAACFRW
FT                   GSSHVFVKRGNFTARFPNSAVRYENQYAAVMMDVGTSWVPKGYVPDVYVVKRRGSRNRR
FT                   FPLSHRAVDQSVPALQSSPVEVVCVSSDKPSSSQKASSPSTSSSSSFNSTRSSDWVNVG
FT                   LSHRTTNKVREPRYAGHFRIGNFTFPRGTVYNTPVDERAYKRVLRLRDTTACSYLRILL
FT                   ARLSGYRPLSDEFFNKCVPSRFVACIEPVESGLVKVHFRSDVFRASFPFDGQPIHPATA
FT                   LTLEVVVSWDWMVTAFQNPLKDGYCYIRHFAEVSLSMGRIFFRRDVDLGPFPYVFEVQH
FT                   RLERLYGKATLRYGVRGQYSAPRCFHCCYNDSPRPMASFIGYHKMGGEDNSLIITDTDR
FT                   LRAVGSAYEKVKRNIPDSLLVRSVEKDILEFNQTLVDMHRSRPGVVVPFQMSENQQVML
FT                   TTAYPEFNINFIHSVHSDHPVAAGSRALENHLVRKHAGTDYSDVGGCPLFHLRAGHSGV
FT                   HVCRPVYDVKDAHRRVVRHHQLSKVSLDQSDGVKQVGWTVNTNSVCWNSACVIMRLKRL
FT                   LWCRFMTCHCENCVELWSTRELRCVICPSSRLVSCWTPVSPSSSKSSTVRWSSTLSPIG
FT                   LFTASTIQRIRTLTLRYANTCVLLVWWWMVFCSLSRWFRSDVALIIIASLNRGFVRESA
FT                   RLNGYAIVGVIVTSLGLRFPGTPVRLVVVYLGVTICTWTPSLYVACTSTWSITALWCTR
FT                   KLLSGLGITSNLASREWCSAGRLYTETNQSLYSTYMGFVRLCCPLASRVGKTRTFLDAY
FT                   PLFRLKLRFSSYWGLLYPRSAATCSWVLRTLWKDASSRTSGIRLICVSWTCPTPYLRLA
FT                   NIQNWTFLSTYRVSVESWTVTKLDLWKTVLNRLYYVKRFKPRLSCVLREAILPKSFRVM
FT                   TMTTRTVMIRVFRSLRTGGSSFGVVVLAGCELEPPLLCLGVYSGNWVGVYVWQRKCWNC
FT                   YSSGWLNRFLVCSGKPLVYRPSLICCLRGSLAGFSMTLFFLRSGKYRSTCPGSSMELSR
FT                   QNWGAFVIYFDCFPSYTLVVRTLSRTLVTLSGRLSRFPLRFWVRVTLNFVSFAWNYLTS
FT                   GLLRFLLVIWEWKHAFQYHYLFLMCLLLFLWGALVFPSFALGFSVVSLWKWDRTFSLRK
FT                   FSVNPKLLVKILSVGLCVWFCGPKRLTSFPWMRKVLFRCSGVIPGVLRIILSSLFSEDD
FT                   AWVGYSKHEVSSLPIVTFCVNRLSYSLERCKEACVAFIVDSAKKILKSLTSEFNESIQN
FT                   SDLTSGAKSLYGHVSSILYTSSGVINKAGSAVATVKAVGSDISGRVKRMRPRFSLSRHF
FT                   DEQTSEYYSASDCSELDESLFSETPGLRGNARCRDLFRIVSRRAVACCEYVTILLNRLA
FT                   SRAGEYSYSYVMDTLVRLYVPTDDVVRRCRSFTFDCTDKASNFVTGFLSWRSLRSGAYS
FT                   APPGLGGGSRGLTSFSHTGGFTRVIGALGNTLSVVFDEEFFRTLLHRLRADVVVLLVEF
FT                   LKNLPVCLFSIYTFNECRGRIFPLREFLWGFCRFVWDVIEGLSINTYQYLSAVAEKVYR
FT                   GAFNRRFNEEDERTLRVITEAEGRIEFLRVVLAEMERFRAASNEVSTSRSSDSPSFPPT
FT                   YGEIEELNDDSSDSALVIGVDNGTGRTIVDGETDSASGSDSDVSIPLDRDFEQIGRLGG
FT                   NGNVDVVRLGLKFVLKLLRNLLDARSFKVLYGLLLQTVFNGGSVNKFVCRLVFSLGTCL
FT                   PFELLRFACSARRLLKSLASFVYQTNLFSEVMVEHLFSVSRLLYDSRYFATVFSELERL
FT                   NFYLDYYLSLPKRYLFPNSRARSCARVSGSRDSGPKEWHQSVRDHLMTYWTLLTLSRCR
FT                   TSMGSRRSLMMGSRIPVVNIRVLRFRSVPSTKKFYMRYMVTAFAKKPRLCSMLPHLAGW
FT                   NATLVVVKTFLFQGKLLCVVNLRVWNRRLVCAITWLPCILRLAQCLTCTLLRVTYRIRN
FT                   SLTPCANSITRKKYPCTNFTGSCVPIGTSCRSQVSIESYREWIWTMMSMLLDFNRKLLV
FT                   GRNGSHPFRNTLKSYCFMFCNDGLVPCPRSQKYDYAFISNQTSFVAANSFLRAVDGKDL
FT                   TFTNEEHSLIVYEAPPGGGKTHSLVNSYADYCVKVSCLVVTANKNSQTEISQRISNELM
FT                   GRKLAAKYVTDCSSRVFTVDSYLMNHLRLTTQLLFIDECFMVHAGAIGAVVEFTSCKAV
FT                   VFFGDSKQIHYIHRNDLGVSFVADIDAFIQPEHRIYGEVSYRCPWDICEWLSEFNPRHV
FT                   ATANVGSIGKSSVSIEEINGCDDVPYDKAAKYIVYTQAEKNDLQKHLGRLTVGRNKVVP
FT                   IVNTVHEVQGETYKRVRLVRFKYQEDTPFSSKNHIVVALSRHVDSLVYSVLTSRRYDDT
FT                   ATNIDRAKEIFDKFRSSNHSYGSSSLEWYLEKYPTEYKGSKASSAPISCINEFLNEVVV
FT                   ASSVVQLGDVSEELSSRPFQSGCDNVTVRDTAPPDSGNLHEPARVRRSKVTSNSSKKCV
FT                   TARKPSVVRKS"
FT   gene            <9355. .10782
FT                   /gene="RdRp"
FT   CDS             <9355. .10782
FT                   /codon_start=1
FT                   /note="46 kDa RNA-dependent RNA polymerase; similar to RNA
FT                   polymerases of other closteroviruses; presumably expressed
FT                   via a +1 ribosomal frameshift"
FT                   /gene="RdRp"
FT                   /function="replication"
FT                   /product="RdRp"
FT                   /protein_id="ABB59452.1"
FT                   /translation="ETPPLLTRVTYTNRLAFGVVRSQAIPPRNASLQENLLSYESRNYN
FT                   FIKTERFVGPSEFGRALAGAVIERCFKMEEMAKIRCDIISLTEANILKWLDKRTPCQIM
FT                   AVHGELKLPFWVEEQISNFKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIFSPC
FT                   FDEFKNRVLSSLNDNIVFFTVMTNAGLAEIIRRIIGDDDNLFIGEVDFSKFDKSQDLFI
FT                   KEYERTLYSEFGFDTELLDVWMEGEYRARATTLDGRLSFSLDGQRRSGGSNTWIGNSLV
FT                   TLGILSLYYDVSKFDLLLVSGDDFLIYSSEKISNFSSQICLETGFETKFMSPSVPYFSS
FT                   KFVVQTGNKTCFVPDPYKLLVKLGAPQIKLTDVELFELFSSFKDMTQDFGDQVVLEKLK
FT                   LLVEPKYGFASGTTMPALCAIHCVRSNFLSFERLFPFIRGWYVVHALNLRQLRKLTNLI
FT                   CERVVYDNRVSYFSVLR"
FT   gene            10908. .11816
FT                   /gene="p33"
FT   CDS             10908. .11816
FT                   /codon_start=1
FT                   /note="33 kDa protein; seems to have no homologs in genomes
FT                   of other closteroviruses"
FT                   /gene="p33"
FT                   /product="p33"
FT                   /protein_id="ABB59453.1"
FT                   /translation="MFAFASESQDLLEEIVFRRRTYHRKYFGDVVKDFTIDIGYDTTDR
FT                   DPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKT
FT                   FDKSRFVFRVKASPSMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLS
FT                   KVCSSSFFFRAVSETATNEFSVATDDVEDVKYIRKQAEPFSRCADPYPPRCYRSTNLGD
FT                   STGVQSRTIEEEGYMTGTAGNVAVTVPNTPLVSAVSPYIAGYNENARSRVSLIRRVCCY
FT                   AVCVLVVSVLIMSGLLAIIYI"
FT   gene            11890. .12045
FT                   /gene="p6"
FT   CDS             11890. .12045
FT                   /codon_start=1
FT                   /note="6 kDa protein; small hydrophobic protein; probably
FT                   membrane-associated; similar to small hydrophobic proteins
FT                   of other closteroviruses"
FT                   /gene="p6"
FT                   /product="p6"
FT                   /protein_id="ABB59454.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFCAFAGLIIIVITIYRCTIKPVRSASPY
FT                   GTHATV"
FT   gene            12051. .13835
FT                   /gene="p65"
FT   CDS             12051. .13835
FT                   /codon_start=1
FT                   /note="65 kDa protein; similar to HSP70 family of heat
FT                   shock proteins"
FT                   /gene="p65"
FT                   /function="putative chaperone"
FT                   /product="p65"
FT                   /protein_id="ABB59455.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATPSELVILKQSNSSYIPTCLLLHAEPN
FT                   SVSYGYDAEYLAASGESGSFYKDLKRWVGCTAKNYQTYLHKLSPSYKVIVKELGTKSVP
FT                   VPYLSPLNNELGLSVALPSLIASYAKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSISMSGYSCVYIINEPSAAAYSTLPKLNSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSSGDMNLGGRDIDKKLSDKIYEMADFVPQKELNVSSLKEALSLQTDPVKYTVNHYG
FT                   MSETVSIDQTVLREIASVFINRTIDILTQVKVKSSMPESQSLKLVVVGGSSYLPGLLDA
FT                   LATVPFVSGIVPVEDARTAVATGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGEQKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASISLFTLGVNWS
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSHYDYAGMPHPTRKLVRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDTLLADLRKTASLGEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   gene            13759. .15363
FT                   /gene="p61"
FT   CDS             13759. .15363
FT                   /codon_start=1
FT                   /note="61 kDa protein; hypothetical protein gene with
FT                   similar position is present in other closteroviruses"
FT                   /gene="p61"
FT                   /product="p61"
FT                   /protein_id="ABB59456.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRNFDERNVSLDHTWSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSMTGIEDRKVPDELISVD
FT                   PHEVGCNFTLIDVESYLMSRGEDFADLAAVEHSWCFSNSCGRLFSSTEIDAYKTLVFTK
FT                   NFDSNVSRVTTKLETYLSYCISLYKKHCMKDDDYFNQILPMFNCLMKVLASLGLFYENH
FT                   ADNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPMDERV
FT                   LIPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLEYVVESDALDDLSQHVDLRLAADNPDL
FT                   RVCLRWAGMFVYYAVYRCVVDRAVERPTLFRLPQKLLTQDDGESCSLHMGSVEALFNLV
FT                   QKVNKDIYVRRQFMGRHSEVAFRLYRNLGLRFPPISSVRLPAHHGYLYVDFYKRVPDGA
FT                   VTAVELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSSRTFRGRGARGASSGHMSRDV
FT                   ATSGFNLPYHGRLYSTS"
FT   gene            15338. .16060
FT                   /gene="CPd"
FT   CDS             15338. .16060
FT                   /codon_start=1
FT                   /note="27 kDa protein; a diverged copy of the coat protein
FT                   that exists at one end of virion"
FT                   /gene="CPd"
FT                   /product="CPd"
FT                   /protein_id="ABB59457.1"
FT                   /translation="MAGYTVLPKTDDKEMDPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEHLKYVMVTMDTFLLENYKTKTEDLLVHLTMIQKRLYTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLLDKVVFPFIISKFTDRETPNALRKFACTFEELHL
FT                   CMARLRPDLYENKRTTRAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   gene            16153. .16824
FT                   /gene="CP"
FT   CDS             16153. .16824
FT                   /codon_start=1
FT                   /note="25 kDa coat protein; CTV coat protein"
FT                   /gene="CP"
FT                   /product="CP"
FT                   /protein_id="ABB59458.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFSSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKHPNLPDKDKDFRIAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADDVVVTNVRQLGKFNT
FT                   R"
FT   gene            16790. .17293
FT                   /gene="p18"
FT   CDS             16790. .17293
FT                   /codon_start=1
FT                   /note="18 kDa protein; seems to have no homologs in other
FT                   closteroviruses"
FT                   /gene="p18"
FT                   /product="p18"
FT                   /protein_id="ABB59459.1"
FT                   /translation="MSGSLGNSTHVDLLRSDSRLLSGWWSFIVNVGDIIVRFALHVSNE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVLDLLEGMNPLAYLFKLAKTTTTICFSMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVVMGTNVDDSRCGCSIWFYNNGTFQNGFIRCNNLVTL
FT                   FSVT"
FT   gene            17327. .17686
FT                   /gene="p13"
FT   CDS             17327. .17686
FT                   /codon_start=1
FT                   /note="13 kDa protein; seems to have no homologs in other
FT                   closteroviruses"
FT                   /gene="p13"
FT                   /product="p13"
FT                   /protein_id="ABB59460.1"
FT                   /translation="MSIRRSWFKVMAVVTVLWYGNEPSISEGYNALMNDDFKFIDTHFT
FT                   NGSYAKKCYDFANFDLDFLRIVIIPLSGGTVNESRADRTNVSEIVESHVSDRDRMSILL
FT                   RNKRIQIPSLLPCDN"
FT   gene            17762. .18313
FT                   /gene="p20"
FT   CDS             17762. .18313
FT                   /codon_start=1
FT                   /note="20 kDa protein; similar hypothetical 20 kDa protein
FT                   is present in the genome of beet yellows virus"
FT                   /gene="p20"
FT                   /product="p20"
FT                   /protein_id="ABB59461.1"
FT                   /translation="MRAYFSVNNYISLLAKVSAVVERLCDPSVTLTEVIDEIDEFNSFL
FT                   ALVHSMKSDVNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSAVD
FT                   VMGFFVMRYMSSSHTKLRVCNENGVEVSSLKVVLSDLSRAHKLDFSERAFAAYGILLQK
FT                   GTVSTVCGQFDINLVSPSCV"
FT   CDS             18395. .19027
FT                   /codon_start=1
FT                   /note="23 kDa protein; putative RNA binding protein;
FT                   detected in tissue extracts from CTV-infected citrus"
FT                   /product="p23"
FT                   /protein_id="ABB59462.1"
FT                   /translation="MDNTSGQTFVSVNLSDESNTATTDVEPVSSEADRLDFLQKMNNPI
FT                   IIDALIRKNSYQGARFRARIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHD
FT                   PVKYLNKRKARAFSNAEIFAIDLVMYTKERQLAIDLAAEREKTRLARRHPMRSPEETPE
FT                   YYKFGRTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           19028. .19300
FT                   /note="no sequence similarity to the respective UTRs of
FT                   other closteroviruses; replication function"
XX
SQ   Sequence 19300 BP; 4653 A; 3898 C; 4839 G; 5910 T; 0 other;

DQ272579 Length: 19300  14-NOV-2005  Type: N  Check: 7223  ..

       1  aatttcacaa attcaacctg ttcgcccaga aaatacgtct ggcacaacag
      51  ggatccggaa taggtccagc ctttaagctc taatattccc acaacaaaaa
     101  ttacactatg tcgaaactca gaggaagctt ctggtcttcg gccatcgctg
     151  ttaacagcga ttacacgata tcgcgcatct ggcgcaaact taacaccata
     201  gagtcctgca ctactttggt tttgttagaa tcaccaaggt ggttcgtgac
     251  aaatcggctg atatgccgat cgtcccttta cggaaatctg tatttccgtt
     301  ttctgttcgc gcggctgtca cgcaattcgt gctgctgggc gtcctcttgc
     351  cgctccgcat tcagggtgcc tctgtggcct tcccgttatc aacgcatctg
     401  gcgttgttcg tccccgctct gtttcgcggg tttttcgagg ttttctctgt
     451  gcaaacctcc gctcacctct gccgctaaga ggtccctccg tcaggcaaag
     501  cgggaatctg tttccctttc tagccgggcc tcttctcgct tctctaggga
     551  agtccctcgc ggcacacgtt caagacttca cagacgtgtg gtgagacgag
     601  ctgacactgc cccagttgag agtccccaag acaagcctac ccgacgaaac
     651  agccgacttg gtaagacttc tcacctccct tacgtggggg aggcagcgtt
     701  ggatgatatc cttcgctgga tcgaagaggt taatcctcat ccctcgatgg
     751  tcgctattcc agtgcccatc acttttggaa ccatgcctgc aacggcttgg
     801  tgttcccact ctgaagccgc agttttgcgt gccgccttga ctatcacgcg
     851  gctgaaactg atttctccac tcaggagaaa cacgtacggt acgtctataa
     901  tgacgtatct tctgccacta accgtccccg tacggtttct ccccgcaagt
     951  gcgtccattt ttcccagtaa atctaaactg ggcgttgagg tcccctctgg
    1001  tagggacctt cacactgcgt tcgtgagatc ttctcacgcg agcgctttct
    1051  tctctgacgc ggttcgcgct tcgtttgttc cgtccagcgc ggaacaattt
    1101  tttcacttcc gtcgtcagcg gacgcatgtt cttgctatta cagacccggt
    1151  cctgtgtggt acggtgtctg ttttaatgtc ggacggtgtt aacacagcac
    1201  gtctcgacgt tgttgctccg gcgtactatg cgtacgctga atctttgggc
    1251  gccagagtgc gctttttgtg ggagtcgtcc gacgtggacg acgctaaagt
    1301  tcgtgacggt caatgttatg tccgtcatgt gttcgacgtg gctctctact
    1351  ttgggagacg cgccgacctt tccgtgcgta gagcgctggg tatgtacccc
    1401  acagtgggtg cactaaaggc ttatcttgtt cgcgaatacg gtcgcgactc
    1451  tcttaaggtt cctatgcgtg ggacctacac ttttggcagt gtgtttcact
    1501  gcttgtcgct aaatcttcaa gtcgacctgc gatctattcc taaccatcat
    1551  ttagttggtg ggacgtctgc ccacgtctta attgggcagg ttcgagtcag
    1601  tgttcctggc tcgattgtta aaccttcacg ttcggccgtt cgtaggcgta
    1651  atagacgcat gcgacgtgat ggttttctcg gtagttccgg ttcttcttct
    1701  tctgcggggg agtcgactcg ctgttcggac tgctcttctc ctcgcggttt
    1751  accttctcct tccgttttaa aaccttccct aggtcggatc ccgagtatag
    1801  atcggcggtt ccggtttcct gcgggtacgc agttgcgcgt ctccgtacct
    1851  aggcgggtcg atgaccatgt ttacgtgtcg actggtagca acttcgatga
    1901  gttgtgccat gcagttttga cacgtatgtc aaaaggtaca actctagaaa
    1951  tccatttaca ctcgattcga gaggggaagg gactacttgg tttagcggcg
    2001  tgcttccgtt gggggtcttc acacgtgttt gtaaagcgtg gcaactttac
    2051  tgcccgattt cctaattcgg cggtcaggta tgagaatcag tatgccgcgg
    2101  ttatgatgga tgtgggcact agttgggttc cgaaggggta cgttcccgat
    2151  gtttatgttg tgaaacgtcg gggaagtcgt aatcgtcgtt ttcctctttc
    2201  ccatcgtgcg gtggatcagt cggtccccgc gttacagtcg agtcctgtcg
    2251  aggttgtttg cgtttcgagt gataagcctt catcgtcgca gaaggcttct
    2301  tcaccttcta cttcttcttc ttcttctttt aactcgacaa ggagttcaga
    2351  ctgggtgaat gtcggcctct ctcatcgaac tactaataag gttcgtgaac
    2401  cgcgttatgc tggtcatttt aggatcggaa attttacttt cccgaggggc
    2451  acagtgtaca acacgcctgt cgatgagcgc gcctataaac gtgttcttag
    2501  attgcgagat accacagcct gttcctatct ccgtatactg ctagctcgtt
    2551  tgtcgggtta cagaccttta agtgacgagt tctttaacaa gtgtgtacct
    2601  tcccggtttg tcgcgtgcat tgaacctgtg gaatcaggtc tcgttaaggt
    2651  gcatttccgt tctgatgttt tccgtgcctc attccctttt gacggtcaac
    2701  ctatacaccc cgccacggca ttgacattgg aagtggtggt ctcttgggat
    2751  tggatggtta cggcttttca gaatcccttg aaggatggat attgctacat
    2801  tcgccatttc gccgaagtta gtttgagcat ggggcgaatt ttcttcagga
    2851  gggacgtcga cttgggacct ttcccatacg ttttcgaagt gcaacaccgt
    2901  cttgaaaggt tgtacgggaa agctacgtta agatacggtg ttaggggtca
    2951  atattcagcc ccgcgctgtt ttcactgttg ctacaacgat tcaccgagac
    3001  cgatggcgtc ctttattggg taccataaga tgggtggtga agataactcc
    3051  ctgataatca cagacaccga caggttgcgt gctgtgggga gtgcctatga
    3101  aaaagtgaag agaaacatac cagattcgtt attggttcgg tctgtagaaa
    3151  aggacatttt agagtttaat cagactctag tcgacatgca tcgatccaga
    3201  ccgggcgttg tcgtaccttt ccaaatgagt gagaatcagc aagtgatgct
    3251  tactaccgcg tacccggaat ttaatattaa ttttattcat tccgtacatt
    3301  ccgatcatcc ggtggcagca ggttctaggg cgttggagaa tcatctcgtt
    3351  cgtaaacacg ctggtaccga ttattcggat gtggggggtt gtccgctgtt
    3401  tcatttacgt gcgggtcact ccggcgttca cgtttgtaga ccggtgtacg
    3451  atgttaaaga cgctcatcgt agagtagtcc gtcatcacca acttagtaag
    3501  gtttcgctag atcagagtga cggtgttaaa caagttggct ggaccgtaaa
    3551  cacgaattct gtgtgctgga attcggcttg tgttatcatg cgtctgaagc
    3601  gattgttatg gtgcaggttt atgacgtgcc attgcgagaa ttgtgtagag
    3651  ctatggtcaa caagagagct tcggtgtgtt atatgcccgt catcacgcct
    3701  ggtgagttgt tggacgcccg tgagtccttc ttcatcaaag agttcgactg
    3751  ttcggtggag ttcgacgctg tcgccgatag ggttgtttac tgcttcaaca
    3801  attcagcgta tacgcacact tactctacga tatgcgaata catgcgtact
    3851  ccttgtgtgg tggtggatgg ttttctgttc actatcgaga tggtttcgct
    3901  cagatgtagc gttaattatt attgcatcac taaatcgcgg gtttgtccga
    3951  gaatcagcga gattaaacgg ttacgctatc gtcggtgtga tagtgacttc
    4001  attaggatta agattccccg gtactccagt aagactcgta gtcgtttacc
    4051  tgggtgttac tatttgtact tggacgccaa gtttgtatgt cgcgtgtacg
    4101  agtacgtggt caataactgc gttgtggtgt acgcgaaaac ttttgagtgg
    4151  acttggaatt acatcaaatc ttgcaagtcg agagtggtgt tcagcgggaa
    4201  gattatacac cgagacgaac caatcgcttt acagtactta tatgggtttt
    4251  gtgcggttat gctgtccgct ggcgtcaagg gtaggcaaaa cgcggacgtt
    4301  tctagacgct tatccgcttt ttcggctgaa acttcgattt tcgagttatt
    4351  ggggtttgct atatccgaga agtgccgcga cttgttcttg ggtattgagg
    4401  acgctgtgga aagatgcgtc aagtcgtacc tcaggaattc gtttaatatg
    4451  tgtttcgtgg acttgtccga ccccttactt acgattagcg aatattcaga
    4501  attggacgtt cctatcgact taccgggttt cggtggaatc gtggacggta
    4551  acgaaactag acttatggaa gacggtgtta aatcggcttt attacgtaaa
    4601  gcggttcaag ccgaggctca gttgtgtctt aagagaggca atacttccga
    4651  aatcgttccg tgtgatgacg atgacgactc gaacggtgat gattcgcgtg
    4701  tttcgctcgt tacggactgg tggttcgtcc ttcggggtgg tagttctggc
    4751  gggttgcgag ctggagccgc cccttctttg tttaggtgtt tactcaggaa
    4801  attgggtggg ggtttatgtt tggcaaagaa agtgttggaa ctgttactca
    4851  agcgggtggt tgaatcgttt tctcgtttgt agcggaaaac cgctcgttta
    4901  tcgtccttcg ctaatttgtt gcttgcgagg ctctcttgcg ggtttttcga
    4951  tgacactgtt ttttctgcgg tctgggaaat atcgatcaac ctgcccagga
    5001  tcgtcgatgg agttgtcaag acaaaactgg ggtgctttcg taatttattt
    5051  cgattgtttc ccaagttata cgctggttgt aaggacgttg tcaaggacgt
    5101  tagtaacgct ttcaggtcgg ttgtctcgtt ttccgctgag gttttgggta
    5151  agagttactc taaactttgt cagttttgct tggaattatt tgacatcggg
    5201  cttattgagg tttctgctcg taatttggga gtggaaacat gcgtttcaat
    5251  atcactatct atttttgatg tgtttattac ttttcctttg gggagcgtta
    5301  gttttcccgt cgtttgcgct agggttttcg gtcgtctcgc tatggaagtg
    5351  ggatcgaact tttagtttaa gaaagttttc ggtaaacccg aaactcttgg
    5401  tgaagatact ttccgtagga ctgtgtgtat ggttttgtgg cccaaagcgt
    5451  ttgacaagct ttccgtggat gcgaaaggtt ttgtttaggt gctctggtgt
    5501  tattcctgga gtgttaagga taatactatc ttccttgttt tccgaagatg
    5551  acgcttgggt gggttatagt aaacatgaag tttcttccct tcctattgtt
    5601  accttttgtg tgaacagatt gtcttattct ctggagcggt gtaaggaagc
    5651  gtgtgtcgca tttattgttg actctgctaa gaagattttg aaatctttaa
    5701  cttcagagtt caacgaatcc attcaaaact ccgacttgac cagtggtgct
    5751  aagtccttgt acgggcacgt gagctcgata ctttacacct ctagtggtgt
    5801  gattaataaa gcaggaagcg ccgtcgctac tgttaaggcg gtcgggagtg
    5851  atatcagtgg tcgtgtgaaa cgtatgcgac cccgattttc tctgtcccgt
    5901  cactttgacg agcagactag tgagtactac tctgctagcg attgttccga
    5951  actagatgag tcgttgttta gtgaaacgcc tggtcttcgt ggaaacgcca
    6001  ggtgtagaga tttgtttcgt atcgtgtcta gacgcgcggt agcgtgttgt
    6051  gagtacgtga caattctttt gaatcggcta gcgtcgcgtg ccggtgaata
    6101  ctcctactcg tatgtgatgg atacgctcgt gagattgtat gtgccgaccg
    6151  atgatgttgt tagacggtgc aggtccttta cgttcgactg tactgataaa
    6201  gcatctaatt tcgtcaccgg gtttcttagt tggcgcagct tacgttctgg
    6251  tgcgtactct gcacctccag gtttgggtgg tggtagtaga ggtttaacgt
    6301  cgttttctca caccggtgga ttcacgcgcg ttatcggcgc tcttgggaac
    6351  accttatcgg tggtgtttga tgaggaattc ttcagaactt tgctgcatcg
    6401  gttgagggca gatgttgtgg ttttactggt ggagttcttg aaaaaccttc
    6451  ccgtttgttt gttttcaata tacactttta atgaatgtcg gggtaggatc
    6501  tttcctttaa gagagttcct atggggtttt tgtcgtttcg tttgggatgt
    6551  tatcgagggg ttgtccatca atacttatca atacctctct gctgtcgctg
    6601  agaaagtgta tcgaggtgcc tttaatcgtc gatttaacga agaggatgag
    6651  aggacgcttc gagtgatcac ggaagcagag ggaagaatcg aatttttgcg
    6701  agttgttctc gcggaaatgg aaaggttccg tgctgcgtcg aacgaggttt
    6751  ctacgtcgag gtcgtctgat agtccttcat tcccacctac ttacggtgaa
    6801  attgaggagt taaatgatga ttcctccgat agtgcgctag tgataggcgt
    6851  cgacaacggt accggccgca ctatcgttga cggtgagacc gattctgcgt
    6901  ccggtagcga tagtgacgtt tctatcccgt tggatcgcga ttttgaacaa
    6951  atcgggcgtc ttggcggaaa cggtaacgtc gatgtcgttc ggctgggttt
    7001  gaaattcgtt ctgaagttgt tacgcaacct attggatgct agaagtttta
    7051  aagtcttgta tgggttgtta cttcaaaccg tttttaatgg tggttcggta
    7101  aataaatttg tgtgtcgtct ggtctttagt cttgggactt gcttaccttt
    7151  cgagttactc cgatttgcgt gttcagcgag gcggttgttg aagagtttgg
    7201  catcatttgt ttaccagact aaccttttca gcgaagttat ggtggagcat
    7251  ttgtttagcg tttcccgact gctttatgat tcccggtact tcgcgactgt
    7301  gttttcggaa ttggagagac ttaacttcta tttagactat tacctttcgc
    7351  tcccgaagag atatctattc cctaattcta gggctcgtag ttgtgctagg
    7401  gtttccggtt cccgtgattc gggaccgaag gagtggcacc agtccgtgag
    7451  agatcactta atgacatact ggactctttt gactctttca aggtgtcgga
    7501  cctcaatggg aagtcgacgt tcgttgatga tggggagtcg gattccggta
    7551  gtgaacattc gggtacttcg atttcgttcg gttccgtcaa cgaagaagtt
    7601  ttacatgcgg tatatggtga cagcgtttgc gaaaaagccc cgtttatgta
    7651  gcatgttacc gcacttagca ggttggaacg ccaccctagt ggtcgtaaag
    7701  acattcctgt ttcaaggaaa acttttgtgc gtggtgaatc ttcgggtgtg
    7751  gaatcgaagg ttagtatgtg cgattacttg gttgccttgt attcttcgtt
    7801  tggcacagtg cctgacatgt accctgttgc gcgtgacata tcgtataaga
    7851  aactcactaa cgccatgcgc gaattctatt actcgcaaaa aatatccttg
    7901  tacgaacttc acgggaagtt gtgttcctat tgggacgagt tgtaggtcgc
    7951  aggtttcgat agaaagttac cgagaatgga tttggacgat gatgtctatg
    8001  ttgttggact ttaatcggaa attgttggtg gggagaaacg gatctcatcc
    8051  gtttcgtaat acgttaaagt cctattgttt tatgttttgt aacgatgggt
    8101  tggttccttg cccgcgttct cagaaatatg attatgcttt catttctaat
    8151  caaacgtctt ttgttgccgc gaattcgttc ttacgtgccg tggatggtaa
    8201  ggatttgact tttaccaatg aggaacatag ccttatcgtt tatgaagctc
    8251  ctcccggtgg tggtaagact cattctttgg tgaattcgta cgcggattat
    8301  tgcgttaaag tatcttgttt agtagtgacc gctaacaaga attctcaaac
    8351  cgagatatct cagcgcatat ctaatgaatt gatgggcagg aagctagctg
    8401  ctaagtatgt taccgattgc agttccagag tgttcactgt agattcttac
    8451  ttaatgaatc acttgcgact tacgactcaa ctgctgttta tcgacgagtg
    8501  cttcatggtt catgctgggg caattggagc cgtggttgag ttcacgtctt
    8551  gtaaagcggt ggttttcttt ggtgatagta agcaaatcca ttacattcac
    8601  cgaaacgatc tcggggtttc ctttgttgca gatattgatg cgtttattca
    8651  accggaacat cgtatttacg gcgaagtgtc ctataggtgt ccttgggaca
    8701  tttgcgagtg gctttccgag tttaacccgc gacacgtagc tactgctaat
    8751  gtagggagta ttgggaagtc gagtgtgtca atagaggaaa tcaatgggtg
    8801  cgatgacgta ccttacgaca aggcggcgaa gtacattgtg tacactcagg
    8851  ctgaaaagaa cgatttgcaa aaacacctcg gtcgcttaac cgtgggtcgg
    8901  aacaaggtag taccaattgt aaataccgtt catgaggtac aaggagagac
    8951  ctataaaagg gtacgtctgg tgaggtttaa gtatcaggag gataccccgt
    9001  tctcttcaaa gaatcatatt gtggttgctt tgagtagaca tgttgattct
    9051  ttggtttatt ccgtacttac tagtaggagg tacgacgata ctgcgactaa
    9101  catagatagg gcgaaggaaa tttttgacaa atttcgttcg tcgaatcact
    9151  cgtacggttc gtcatcgtta gagtggtacc ttgaaaagta tcctaccgaa
    9201  tataagggta gtaaagcatc ctctgctccg ataagttgca ttaacgaatt
    9251  tcttaatgag gtcgtcgttg cttcttctgt cgtgcagttg ggtgatgtgt
    9301  ctgaagaact aagttcacgt ccctttcaat cgggttgtga taatgttact
    9351  gtaagagaca ccgcccctcc tgactcgggt aacttacacg aaccggctcg
    9401  cgttcggcgt agtaaggtca caagcaattc ctccaagaaa tgcgtcactg
    9451  caagaaaacc ttctgtcgta cgaaagtcgt aattataact ttatcaagac
    9501  ggaacggttt gttggaccaa gcgaatttgg tagggcgttg gctggtgctg
    9551  ttatcgaacg ttgtttcaaa atggaagaga tggctaagat aaggtgtgat
    9601  attatatccc ttactgaagc taacatttta aaatggctcg ataagcgcac
    9651  tccctgtcaa ataatggccg tacacgggga gttgaaactt cccttttggg
    9701  tggaggagca aatttccaac ttcaaactga tggttaaacg tgatgctaag
    9751  gtaaaacttg acgattcaag tctatctaaa catcccgctg ctcagaacat
    9801  catgtttcat aagaagttta tcaatgccat attttccccg tgtttcgacg
    9851  agttcaaaaa tagagtgttg tcctcgctta atgacaatat cgtgttcttt
    9901  actgtgatga cgaacgctgg gttagcggaa attatcagaa gaatcattgg
    9951  tgacgacgac aacttattta ttggggaagt ggatttcagt aagttcgata
   10001  agtctcagga tttgttcatt aaagagtacg aacgtacgtt gtattccgag
   10051  tttggtttcg ataccgaact tctcgatgtg tggatggaag gtgagtatcg
   10101  cgctagagcc accacgctgg acggtcgact gagtttttca cttgatggtc
   10151  agcgtcgttc tggaggttca aacacttgga ttgggaattc cttggttact
   10201  ctaggtatcc tttcgttata ttacgacgtt tcgaagtttg acttactcct
   10251  cgtttctgga gacgattttt taatttattc gagtgaaaag ataagcaact
   10301  tttcttccca aatttgctta gaaacaggtt ttgagactaa gtttatgtct
   10351  ccgagcgtgc catattttag ctcaaagttt gtggttcaga ccggtaacaa
   10401  aacgtgtttt gtgcctgacc cttataaatt attagtaaag ttgggggctc
   10451  cacaaattaa gttaaccgat gtcgagttat ttgagttgtt cagttctttt
   10501  aaggacatga cgcaggactt tggtgatcaa gtggttttgg agaagctgaa
   10551  gttgctagtc gaacctaagt acggtttcgc tagtgggacc actatgccag
   10601  cattgtgcgc tattcattgt gtgcgatcga actttctgtc ctttgagagg
   10651  ttatttcctt tcattagggg ttggtatgtt gttcacgctc taaatctcag
   10701  acagcttagg aaactcacta atttgatctg tgaacgtgta gtttacgaca
   10751  atcgggtgag ttatttttcg gtacttcgat aacccgttca ctaaacctgc
   10801  acgctaacga cgataacgtg gacgacctcg gacaagcggg tgaattagca
   10851  accggctgat cgattgatta gttctcgctg agagctaatg tgggtagttg
   10901  agtcaggatg tttgccttcg cgagcgaaag ccaagacttg ttagaagaaa
   10951  ttgtttttcg tcgtagaact taccatcgta aatattttgg tgacgtggtt
   11001  aaggacttca ctatcgatat tggttatgat actaccgatc gcgatcctac
   11051  tgtattggcc gattatttct cattgtattt ctttttactt aacaacgata
   11101  gtgttgggcc tatagcagcc tcaattgtgg taagcccacc ggttagcggg
   11151  actcataaaa ttcgagcgca tatcgataat caaccgaact gtgaaggtaa
   11201  cgtgacttac gttaaaacct tcgacaaaag tcgctttgtg tttcgcgtta
   11251  aagcgtcccc gtctatgaga ggttactact cttttcgggt gtttcttagt
   11301  agcgatgtcg ctagcgaacg cagcgagttc gtgtgcagtt ttgttggtag
   11351  caggtttctt tgctgttgta cacaaacgat atctgaaaat ttgagtaaag
   11401  tttgttcatc ttccttcttc ttcagagcag tttcagaaac cgcgaccaac
   11451  gaattttctg ttgcgactga tgatgtggaa gacgttaagt acataagaaa
   11501  acaagccgag cctttttcac gttgcgctga cccataccct cctaggtgtt
   11551  atcgtagcac taatttgggc gattctacag gggttcagag tcgtacgatt
   11601  gaagaggaag gttatatgac gggcactgca ggtaacgtcg cagtcaccgt
   11651  cccgaatact ccactagtta gtgctgtctc tccgtatatc gcagggtaca
   11701  acgagaatgc acgctcgcgc gtctcattaa tacgccgggt ctgttgttac
   11751  gccgtttgcg ttttagtggt gtccgttctt ataatgagcg gtttattagc
   11801  cattatatat atatgattta gtgtagtaac tcataaggta caattactta
   11851  cttaagactc gccgtttgac tctgtttaaa cggggtttaa tggactgcgt
   11901  aattcaaggg tttttaactt tcctagttgg tatagctgtg ttttgtgcct
   11951  ttgccggact gattatcatt gttataacaa tttatcggtg cacgattaag
   12001  cccgtcagaa gtgcttcccc ttacggcact cacgcgactg tctaagcggt
   12051  atggtgcttt tgggtttaga cttcggtacc acgttttcaa cggtggctat
   12101  ggctacacct tcagagttag ttatactcaa acaatccaat tcatcgtaca
   12151  tacctacgtg tttactcctg catgcggaac ctaacagcgt atcttatggt
   12201  tacgatgcgg aatatttagc ggcttctggg gagtctggtt cgttttacaa
   12251  agatttgaag cggtgggtgg gttgcactgc gaagaactac caaacctact
   12301  tacacaaact atcaccttcc tataaggtga tagtgaaaga gttgggaact
   12351  aagagcgtgc cggtgccata tttgtcacct ctgaataacg aattaggact
   12401  cagcgtcgct ttaccttcac tgattgcttc gtatgccaaa tccattctgt
   12451  cggatgcgga acgagtgttc aatgtaagct gcactggagt tatatgttcg
   12501  gtacctgctg gttataacac gttacaacga gcttttacac agcagagcat
   12551  atcgatgtcg ggttactctt gtgtgtacat tattaacgaa ccttcagcag
   12601  ccgcgtactc cactttacct aagttgaatt cggcagataa gtatttagcc
   12651  gtttacgact tcggcggtgg gacttttgat gtctctatag ttagcgttag
   12701  attacccact ttcgccgtta gaagttcgag cggtgacatg aatttaggcg
   12751  gtagagatat cgacaaaaag ttatccgata aaatatacga aatggctgat
   12801  tttgtgccgc aaaaagaatt gaacgtttct agtttaaagg aagctttatc
   12851  tcttcaaacc gatccggtca aatatactgt gaatcattac ggaatgagtg
   12901  agaccgtatc aattgatcaa acggtgttga gggagatagc ctcggtgttc
   12951  ataaatcgaa cgatagatat acttacgcaa gttaaggtta agtctagtat
   13001  gcccgaatcg caaagtttga agttagtggt agtcggtgga agctcgtacc
   13051  taccagggtt gttggacgct ttggcaaccg tgccttttgt gtctgggata
   13101  gtgccggtgg aagacgcaag aaccgctgtc gccacagggt gcgctttgta
   13151  tagcgagtgc ttagatggta ggtctaaggc cctactaata gattgtatta
   13201  cgcatcattt gtcggtcacg acgtttagcg cggattcggt cgttgttgca
   13251  gcggccggta gtccaattcc ttttgaaggt gaacaaaaac tcacgttacg
   13301  caaatgcgtt agtacgtcta actatcaagc aagaatgttc gaaggggatt
   13351  acgaaaaagt tttccgaaat gaacgtatat acgcagcttc gatatcattg
   13401  tttacattag gagttaattg gagtgtgcct aacgacgttg agatgactct
   13451  cgtgaccaaa gtggactcga tgggtaaagt ggaattttac cttaaaggtc
   13501  catctggtga actggttaac gtgcaaggta cttcgcatta cgattatgct
   13551  ggtatgcctc accccactag aaagctggtg aggcttagcg attacaatgt
   13601  aaactccgcc gctttagttt tagctttgac attaactcgc gaaaaacgag
   13651  aaaagttcct tttgcgaaca ttatttgaca ctttactagc ggatttacga
   13701  aagacagcaa gtttaggcga gtactcaaag aagtacccga tcactcgaaa
   13751  cgatatcgat gtcgtctcat cacgtatggg gatcgttgtt tcgaaagttt
   13801  tacggggaag cgatttggaa agaatacctc tctgaatcaa ctcgaaattt
   13851  cgatgaaaga aatgtatcgt tagaccacac ttggagttcg ggtgtggtcg
   13901  tccgtaggca gagtcttttg aatgcgcctc aaggtacttt cgagaacgag
   13951  ttagcgctat tgtacaattc ggtggtgatt aacgattttg ttgagttgac
   14001  tggtatgccc ttgaaatcta tgacaggtat cgaagaccgt aaggtacctg
   14051  acgaattaat atccgttgac ccgcacgaag tcggatgtaa cttcacgtta
   14101  atcgacgtgg aatcgtatct aatgagcagg ggtgaagatt tcgctgatct
   14151  agcggcggtc gagcattcgt ggtgtttcag caactcttgt ggtagactat
   14201  ttagttcgac tgagatagat gcttacaaaa ccttggtgtt tactaagaat
   14251  tttgatagta atgtatcccg agtgactact aagttagaga cttatctatc
   14301  gtactgcata tcattgtaca agaaacattg catgaaagac gatgattatt
   14351  ttaatcaaat cttacctatg tttaattgtt taatgaaagt gctggcgtcg
   14401  cttggtttgt tttatgagaa tcatgccgac aatccgctac tgaccggaat
   14451  gctcatagag ttttgcctag aaaataaggt gtattactct acttttaaag
   14501  tgaatttaga caacgtcaga ttgtttaagt ctaaagtgtt gcctgtggtg
   14551  ttaacggttt gggatatatc cgagcctgat gacccaatgg atgaaagggt
   14601  gctgattcct ttcgatccta cggatttcgt gctcgattta cctaaattga
   14651  atatacacga tacaatggtg gtggtgggta atcaaatcag acagttagaa
   14701  tacgtagtcg aaagcgatgc tttagacgat ctatctcaac acgttgattt
   14751  acgtttagca gcggacaatc ccgatctacg cgtttgtctg cgttgggcag
   14801  ggatgtttgt gtactacgct gtttatcggt gtgttgttga tagagcggtg
   14851  gaacgaccga cgttgtttag attgccgcag aaactactga ctcaggatga
   14901  tggcgaatcg tgctcattac acatgggttc cgtcgaagct ttattcaatc
   14951  tggtgcagaa agtgaacaag gacatttacg ttagacgtca gttcatggga
   15001  cgtcatagtg aagtggcttt tcgactgtat cgcaacttag gtttgaggtt
   15051  tccaccgatc tcatcggtta ggttaccggc tcatcacggt tatttatacg
   15101  tcgattttta caaaagagta cctgacggtg ctgttaccgc cgtcgaactc
   15151  gaaagtttac gtcaattacg ctcatccgtg gacgttatgt gtaaggacag
   15201  ggtgtcaatc acacctccac cattcaatcg acttagaaga ggatcttcta
   15251  gaacatttag aggtcgaggc gcacgcggtg cgagctcggg tcatatgagc
   15301  agagacgtgg cgacttccgg gtttaattta ccttatcatg gcaggttata
   15351  cagtacttcc taaaaccgat gataaagaaa tggatcctgt gagtgctgcc
   15401  gtgcccggta agtatccgga tgtcattgaa aagttcgtgg ccaataggtc
   15451  cgtagatgcg ttaatagaag gcgttataag taaattggat accaattcaa
   15501  tatacgaaga ttccactgaa aagtttactg gtgaacactt gaaatacgtt
   15551  atggttacta tggacacttt cttattagaa aactacaaaa cgaaaacgga
   15601  agatctgttg gttcacttaa ctatgatcca aaagaggtta tacactatat
   15651  ccacgagcac taaaaccaag tttcgcgata aaggttgtat tagttacgta
   15701  caagggggtt tacgatataa gttgttggac aaagtagttt ttcctttcat
   15751  tatatcgaaa tttaccgaca gggagactcc aaacgctcta cgtaagtttg
   15801  cttgcacttt cgaggagtta cacttgtgta tggctaggtt aagacccgac
   15851  ttatacgaaa ataaaaggac gaccagggct gggactccac atttaaaggg
   15901  ctacctatca gctgactttc tctcaggttc tctccctggg tactccgaac
   15951  atgaacgagg tatcattctt cgagcgtccg agtctatgtt agctagacgt
   16001  caaggttacg aggaggcgac cgagcttctt aacctacgcg atttgggtaa
   16051  gtacttatag tggtttgggg acggtaacat tatactatcc catgagcgct
   16101  gccttaaggg tcgttaattg acgacttttg atatatttac taggtttgaa
   16151  ttatggacga cgaaacaaag aaattgaaga acaaaaacaa ggaaacaaaa
   16201  gaaggcgacg atgttgttgc tgccgagtct tctttcagtt ccgtaaactt
   16251  acacatcgat ccgactttga taacgatgaa cgatgtgcgt cagttgagta
   16301  cccaacagaa cgctgctttg aacagagact tattccttac tttgaaaggg
   16351  aagcatccta acttacctga taaagataag gactttcgca tagctatgat
   16401  gttgtatcgt ttagcagtta agagttcatc attacaaagc gatgacgacg
   16451  ccacgggtat aacgtacact cgggagggtg ttgaagtgga tttgtctgac
   16501  aaactttgga ctgacgtcgt gtttaactct aagggtattg gtaaccgtac
   16551  taacgccctt cgagtttggg gtagaactaa cgatgccctt tacttagctt
   16601  tttgcagaca gaatcgcaat ttgagttatg gcggacgtcc gctagacgca
   16651  gggattccgg ccgggtatca ttacttgtgt gcggatttct tgactggggc
   16701  tggtttgact gatttagaat gtgctgtgta catacaagct aaagaacaat
   16751  tattgaagaa gcgaggggct gatgatgtcg tagttactaa tgtcaggcag
   16801  cttgggaaat tcaacacacg ttgatctgtt gcgttccgat tcccggttac
   16851  tatcgggatg gtggagtttc atcgtgaacg tgggtgatat aatcgtccgg
   16901  ttcgcgttac acgtttctaa tgaagatatg ctgaatagtt tttcagctat
   16951  atcgaattgt acgattatag cggacggtag tgctttacta aaagataata
   17001  ctgtgctcga tcttttagaa ggcatgaatc ctttggctta tttatttaaa
   17051  ttagcgaaaa cgactactac tatttgtttt tctatgtcta ataaggttct
   17101  ttttggtact actaaatccg aaccacttag ttgtttagct atcacgtcgg
   17151  atcgagtttt attcaaagtt gttatgggta ctaacgttga cgattctcga
   17201  tgcggctgca gtatttggtt ttacaacaac ggtacgtttc aaaatggatt
   17251  tatccgttgt aataatctcg tcactttgtt tagcgtgact tagacacgaa
   17301  gagactgttc ggattcaatt gctgcaatga gcattcggcg ctcgtggttt
   17351  aaggttatgg ctgtagttac ggtattatgg tacggtaatg agccttccat
   17401  tagtgaaggt tacaatgctc tcatgaatga tgactttaag tttatcgata
   17451  cgcattttac aaacggttct tacgctaaga aatgttacga tttcgctaat
   17501  ttcgatttag actttctacg catcgttatc attcctttga gtgggggtac
   17551  ggtgaatgaa tcgcgtgctg atcgcactaa cgtttcagaa attgtcgaat
   17601  cgcatgtgag cgaccgagac aggatgagca tcttgttgcg taataagcgg
   17651  atccaaattc cttcgctctt accttgcgat aactagagtc tactcagtag
   17701  tacgtctatt agtataacgt attaagcact ttagtaaagg gttttgttta
   17751  aatcaaacaa tatgcgagct tactttagtg ttaacaatta cataagcctt
   17801  ttggctaagg tcagcgcagt tgtggaacgt ttatgcgatc ccagcgtaac
   17851  tctcacggaa gtgatagacg aaattgatga atttaactcg tttctcgctt
   17901  tggtgcactc tatgaagtca gacgtgaacg gagaccatca ggatggccac
   17951  catgagatgg gtgaacacaa gtctcgattg ttatgcaata tagaggcgaa
   18001  attgcgagta cttctcgaca ttataaggcg tcggttcact cgcgaaaagc
   18051  tgctttgtac cagcgcggta gatgtcatgg gcttcttcgt tatgaggtac
   18101  atgagctcca gccacactaa gcttcgagtc tgtaatgaga acggagttga
   18151  agttagtagt ttaaaggtgg tactgtcgga tctgtcccgc gcgcataagt
   18201  tggattttag cgagcgagct tttgctgctt acggtatcct tttgcaaaag
   18251  gggaccgtgt cgaccgtttg cggccagttt gacattaatt tagtctctcc
   18301  atcttgcgtg taggttaata cgcttctcag aacgtgtggt tgtattaact
   18351  aactttaatt cgaacaaata tattgtgaaa gtctgcgagt tacaatggat
   18401  aatactagcg gacaaacttt cgtttctgtg aacctttctg acgaaagcaa
   18451  cacagcgacc actgacgtcg aacccgtgag ttcggaagcg gatcgcttgg
   18501  attttttaca gaaaatgaat aatcccatta ttatcgatgc tttgatacgg
   18551  aagaatagtt atcagggcgc tcgctttcgc gcgagaataa taggagtgtg
   18601  cgtggattgc ggtagaaaac acgataaggg gttgaagact gaacgtaagt
   18651  gtaaggtcaa caatacgcag tctcagaacg aggtggcgca tatgttaatg
   18701  cacgaccccg ttaagtattt aaacaaaaga aaagctagag ccttttctaa
   18751  tgcggagata tttgcgattg atttggttat gtacaccaag gaaaggcaat
   18801  tggctattga tttggccgct gaaagggaga aaacgagact ggctcgtaga
   18851  cacccgatgc gttctccgga agaaactccg gaatattata aattcggtag
   18901  gactgctaaa gcaatgttac cggacatcaa cgccgtagac gttggtgata
   18951  acgaggaaac ttcgtcggag tatccagtga gtctgagtgt ttctggcgga
   19001  gttctccgtg aacaccactt catctgattg aagtggacgg aataagttcc
   19051  tcgcggaact ttgtgttggg ttggtaaaga cccttatgat ggtgatatat
   19101  cactagacaa taaccggatg ggtaaagtct ttaaaatgat cgaggggaaa
   19151  attaaccgta tcctctcgtt ggtctaagct cccacagagt ggtagtggtc
   19201  tcaagtgagg cttaacgtat gcgtgaacca aagaagttct ccttagagtg
   19251  tgtgttgttt acccaacaca ctgtccctat ggggggccaa cataggtcca