Sequence of DPV Murine norovirus 1

Murine norovirus 1 polyprotein, capsid protein, and small basic protein genes, complete cds.

ACC No: DQ285629

Dated: 2005-12-08 | Length: 7382 | CRC: 473721062

                
ID   DQ285629   standard; genomic RNA; VRL; 7382 BP.
XX
AC   DQ285629;
XX
SV   DQ285629.1
XX
DT   05-DEC-2005 (Rel. 86, Created)
DT   08-DEC-2005 (Rel. 86, Last updated, Version 4)
XX
DE   Murine norovirus 1 polyprotein, capsid protein, and small basic protein
DE   genes, complete cds.
XX
KW   .
XX
OS   Murine norovirus 1
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae;
OC   Norovirus.
XX
RN   [1]
RP   1-7382
RX   DOI; 10.1371/journal.pbio.0020432.
RX   PUBMED; 15562321.
RA   Wobus C.E., Karst S.M., Thackray L.B., Chang K.O., Sosnovtsev S.V.,
RA   Belliot G., Krug A., Mackenzie J.M., Green K.Y., Virgin H.W.;
RT   "Replication of Norovirus in cell culture reveals a tropism for dendritic
RT   cells and macrophages";
RL   PLoS Biol. 2(12):E432-E432(2004).
XX
RN   [2]
RP   1-7382
RA   Wobus C.E., Karst S.M., Thackray L.B., Chang K.-O., Sosnovtsev S.V.,
RA   Belliot G., Krug A., Mackenzie J.M., Green K.Y., Virgin H.W. IV.;
RT   ;
RL   Submitted (08-NOV-2005) to the EMBL/GenBank/DDBJ databases.
RL   Pathology and Immunology, Washington University School of Medicine, 660
RL   South Euclid Ave, St. Louis, MO 63110, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7382
FT                   /country="USA"
FT                   /db_xref="taxon:223997"
FT                   /mol_type="genomic RNA"
FT                   /note="plaque purified; passaged three times"
FT                   /organism="Murine norovirus 1"
FT                   /isolate="MNV-1"
FT                   /clone="CW1"
FT                   /sub_clone="P3"
FT   5'UTR           1. .5
FT   CDS             6. .5069
FT                   /codon_start=1
FT                   /note="ORF1; encodes helicase, protease, and polymerase"
FT                   /product="polyprotein"
FT                   /protein_id="ABB90153.1"
FT                   /translation="MRMATPSSAPSVRNTEKRKNKKASSKASVSFGAPSPLSSESEDEI
FT                   NYMTPPEQEAQPGALAALHAEGPLAGLPVTRSDARVLIFNEWEERKKSDPWLRLDMSDK
FT                   AIFRRYPHLRPKEDRPDAPSHAEDAMDAKEPVIGSILEQDDHKFYHYSVYIGGGLVMGV
FT                   NNPSAAVCQATIDVEKLHLWWRPVWEPRHPLDSAELRKCVGMTVPYVATTVNCYQVCCW
FT                   IVGIKDTWLKRAKISRDLPFYSPVQDWNVDPQEPFIPSKLRMVSDGILVALSAVIGRPI
FT                   KNLLASVKPLNILNIVLSCDWTFSGIVNALILLAELFDIFWTPPDVTNWMISIFGEWQA
FT                   EGPFDLALDVVPTLLGGIGMAFGLTSETIGRKLASTNSALKAAQEMGKFAIEVFKQIMA
FT                   WIWPSEDPVPALLSNMEQAIIKNECQLENQLTAMLRDRNAGAEFLRSLDEEEQEVRKIA
FT                   AKCGNSATTGTTNALLARISMARAAFEKARAEQTSRVRPVVIMVSGRPGIGKTCFCQNL
FT                   AKRIAASLGDETSVGIIPRADVDHWDAYKGARVVLWDDFGMDNVVKDALRLQMLADTCP
FT                   VTLNCDRIENKGKMFDSQVIIITTNQQTPVPLDYVNLEAVCRRIDFLVYAESPVVDDAR
FT                   ARAPGDVNAVKAAMRPDYSHINFILAPQGGFDRQGNTPYGKGVTKIIGATALCARAVAL
FT                   VHERHDDFGLQNKVYDFDAGKITAFKAMAADAGIPWYKMAAIGCKAMGCTCVEEAMHLL
FT                   KDYEVAPCQVIYNGATYNVSCIKGAPMVEKVKEPELPKTLVNCVRRIKEARLRCYCRMA
FT                   ADVITSILQAAGTAFSIYHQIEKRSRPSFYWDRGYTYRDGPGSFDIFEDDDDGWYHSEG
FT                   KKGKNKKGRGRPGVFRTRGLTDEEYDEFKKRRESRGGKYSIDDYLADREREEELLERDE
FT                   EEAIFGDGFGLKATRRSRKAERAKLGLVSGGDIRARKPIDWNVVGPSWADDDRQVDYGE
FT                   KINFEAPVSIWSRVVQFGTGWGFWVSGHVFITAKHVAPPKGTEIFGRKPGDFTVTSSGD
FT                   FLKYYFTSAVRPDIPAMVLENGCQEGVVASVLVKRASGEMLALAVRMGSQAAIKIGSAV
FT                   VHGQTGMLLTGSNAKAQDLGTIPGDCGCPYVYKKGNTWVVIGVHVAATRSGNTVIAATH
FT                   GEPTLEALEFQGPPMLPRPSGTYAGLPIADYGDAPPLSTKTMFWRTSPEKLPPGAWEPA
FT                   YLGSKDERVDGPSLQQVMRDQLKPYSEPRGLLPPQEILDAVCDAIENRLENTLEPQKPW
FT                   TFKKACESLDKNTSSGYPYHKQKSKDWTGSAFIGDLGDQATHANNMYEMGKSMRPIYTA
FT                   ALKDELVKPDKIYGKIKKRLLWGSDLGTMIRAARAFGPFCDALKETCIFNPIRVGMSMN
FT                   EDGPFIFARHANFRYHMDADYTRWDSTQQRAILKRAGDIMVRLSPEPDLARVVMDDLLA
FT                   PSLLDVGDYKIVVEEGLPSGCPCTTQLNSLAHWILTLCAMVEVTRVDPDIVMQESEFSF
FT                   YGDDEVVSTNLELDMVKYTMALRRYGLLPTRADKEEGPLERRQTLQGISFLRRAIVGDQ
FT                   FGWYGRLDRASIDRQLLWTKGPNHQNPFETLPGHAQRPSQLMALLGEAAMHGEKYYRTV
FT                   ASRVSKEAAQSGIEMVVPRHRSVLRWVRFGTMDAETPQERSAVFVNEDE"
FT   CDS             5056. .6681
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /protein_id="ABB90154.1"
FT                   /translation="MRMSDGAAPKANGSEASGQDLVPAAVEQAVPIQPVAGAALAAPAA
FT                   GQINQIDPWIFQNFVQCPLGEFSISPRNTPGEILFDLALGPGLNPYLAHLSAMYTGWVG
FT                   NMEVQLVLAGNAFTAGKVVVALVPPYFPKGSLTTAQITCFPHVMCDVRTLEPIQLPLLD
FT                   VRRVLWHATQDQEESMRLVCMLYTPLRTNSPGDESFVVSGRLLSKPAADFNFVYLTPPI
FT                   ERTIYRMVDLPVIQPRLCTHARWPAPVYGLLVDPSLPSNPQWQNGRVHVDGTLLGTTPI
FT                   SGSWVSCFAAEAAYEFQSGTGEVATFTLIEQDGSAYVPGDRAAPLGYPDFSGQLEIEVQ
FT                   TETTKTGDKLKVTTFEMILGPTTNADQAPYQGRVFASVTAAASLDLVDGRVRAVPRSIY
FT                   GFQDTIPEYNDGLLVPLAPPIGPFLPGEVLLRFRTYMRQIDTADAAAEAIDCALPQEFV
FT                   SWFASNAFTVQSEALLLRYRNTLTGQLLFECKLYNEGYIALSYSGSGPLTFPTDGIFEV
FT                   VSWVPRLYQLASVGSLATGRMLKQ"
FT   CDS             6681. .7307
FT                   /codon_start=1
FT                   /product="small basic protein"
FT                   /protein_id="ABB90155.1"
FT                   /translation="MAGALFGAIGGGLMGIIGNSISNVQNLQANKQLAAQQFGYNSSLL
FT                   ATQIQAQKDLTLMGQQFNQQLQTNSFKHDLEMLGAQVQAQAQAQENAINIKTAQLQAAG
FT                   FSKTDAARLALGQQPTRAVDWSGTRYYTANQPVTGFSGGFTPTYTPGRQVTSRPVDTSP
FT                   LPISGGRLPSLRGGSWSPRDHTPATQGTYTNGRFVSLPKIGSSRA"
FT   3'UTR           7308. .7382
XX
SQ   Sequence 7382 BP; 1555 A; 2133 C; 2053 G; 1641 T; 0 other;

dq285629 Length: 7382  08-DEC-2005  Type: N  Check: 4644  ..

       1  gtgaaatgag gatggcaacg ccatcttctg cgccctctgt gcgcaacaca
      51  gagaaacgca aaaacaagaa ggcttcgtct aaagctagtg tctcctttgg
     101  agcacctagc cccctctctt cggagagcga agacgaaatt aattacatga
     151  cccctcctga gcaggaagct cagcccggcg cccttgcggc ccttcatgcg
     201  gaagggccgc ttgccgggct ccccgtgacg cgtagtgatg cacgcgtgct
     251  gatcttcaat gagtgggagg agaggaagaa gtctgatccg tggctacggc
     301  tggacatgtc tgataaggct atcttccgcc gttaccccca tctgcggcct
     351  aaggaggata ggcctgacgc gccctcccat gcggaggacg ctatggatgc
     401  caaggagcct gtgatcggct ctatcttgga gcaggatgat cacaagtttt
     451  accattactc tgtctacatc ggtggcggcc ttgtgatggg ggtcaacaac
     501  cccagtgctg cggtctgcca ggcaacgatt gatgtggaga agctacacct
     551  ctggtggcgg cctgtctggg agccccgcca tccccttgac tcggctgagt
     601  tgaggaagtg cgtgggcatg actgtcccct acgtggccac caccgtcaac
     651  tgttatcagg tctgctgctg gattgttggc atcaaggaca cctggctgaa
     701  gagggcgaag atctctagag atctgccctt ctacagcccc gtccaggact
     751  ggaacgtcga cccccaggag cccttcattc catccaagct caggatggtc
     801  tcggatggca tcctggtggc cttgtcggca gtgattggcc ggccaattaa
     851  gaacctactg gcctcagtta agccgctcaa cattctcaac atcgtgctga
     901  gctgtgattg gaccttttcg ggcattgtca atgccctgat cttgcttgct
     951  gagctctttg acatcttttg gaccccccct gatgtgacca actggatgat
    1001  ctctatcttc ggggaatggc aggccgaagg gcccttcgac cttgctcttg
    1051  acgtggtgcc caccctgttg ggcgggatcg ggatggcttt tggcctcacc
    1101  tctgagacca tcgggcgcaa gctcgcttcc accaactcgg ctctcaaggc
    1151  cgcccaagag atgggcaagt tcgccataga ggtcttcaag caaattatgg
    1201  cctggatctg gccctctgag gacccagtgc cagccctctt atccaacatg
    1251  gagcaggcca tcattaagaa tgagtgtcaa ctggagaacc aactcacggc
    1301  catgttgcgg gatcgcaacg caggggctga attcctaagg tcccttgatg
    1351  aggaggagca ggaagtccgc aagatcgcag ctaagtgcgg caactcggcc
    1401  accactggaa ccaccaacgc tctgctggcc aggatcagca tggcccgcgc
    1451  ggcctttgag aaagctcgcg ctgaacagac ctcccgagtc cgccctgtgg
    1501  tgatcatggt ctcaggcagg cccgggatcg ggaaaacctg cttttgccaa
    1551  aacctggcca agaggattgc tgcgtccctg ggtgatgaga cctctgttgg
    1601  catcatacca cgcgctgatg tcgaccactg ggatgcttac aagggagcca
    1651  gagtggttct ctgggatgat ttcggcatgg acaacgtggt gaaggatgca
    1701  ctgaggcttc agatgcttgc cgacacgtgc ccagtgacac tcaattgtga
    1751  caggattgag aacaagggaa agatgtttga ctctcaggtc attatcatca
    1801  ccacaaatca acaaaccccc gtgcccctgg actatgtcaa cctggaggcg
    1851  gtctgccgcc gcatagattt cctggtttat gctgagagcc ctgttgttga
    1901  tgatgctcgg gccagagccc ctggcgatgt gaatgcagtg aaagctgcca
    1951  tgaggcccga ttacagccac atcaatttca tcttggcacc gcagggcggc
    2001  tttgaccgtc agggaaacac cccctacggt aagggcgtca ccaagatcat
    2051  tggcgccact gctctttgcg cgagagcggt tgctcttgtc catgagcgcc
    2101  atgatgattt cggcctccag aacaaggtct atgactttga tgccggcaag
    2151  atcaccgcct tcaaagccat ggcggctgac gccggcattc catggtacaa
    2201  aatggcagct attgggtgca aagcaatggg gtgcacctgt gtagaggagg
    2251  ccatgcattt acttaaggat tatgaggtgg ctccctgtca ggtgatctac
    2301  aatggtgcca cctataatgt gagctgcatc aagggtgccc caatggttga
    2351  aaaggtcaag gagcctgaat tgcccaaaac acttgtcaac tgtgtcagaa
    2401  ggataaagga ggcccgcctc cgctgctact gtaggatggc tgctgacgtc
    2451  atcacgtcca ttctgcaggc ggccggcacg gccttctcta tttaccacca
    2501  gattgagaag aggtctagac catcctttta ttgggatcgt ggatacacct
    2551  accgtgacgg acctggatcc tttgacatct ttgaggatga cgatgatggg
    2601  tggtaccact ctgagggaaa gaagggcaag aacaagaagg gccgggggcg
    2651  acccggagtc ttcagaaccc gtgggctcac ggatgaggag tacgatgaat
    2701  tcaagaagcg ccgcgagtct aggggcggca agtactccat tgatgattac
    2751  ctcgctgacc gcgagcgaga agaagaactc ctggagcggg acgaggagga
    2801  ggctatcttc ggggatggct tcgggttgaa ggccacccgc cgttcccgca
    2851  aggcagagag agccaaactg ggcctggttt ctggtggcga catccgcgcc
    2901  cgcaagccga tcgactggaa tgtggttggc ccctcctggg ctgacgatga
    2951  ccgccaggtc gactacggcg agaagatcaa ctttgaggcc ccagtctcca
    3001  tctggtcccg tgttgtgcag ttcggcacgg ggtggggctt ttgggtgagc
    3051  ggccacgtct tcatcaccgc caagcatgtg gcgcccccca agggcacgga
    3101  gatctttggg cgcaagcccg gggacttcac tgtcacttcc agcggggact
    3151  tcttgaagta ctacttcacc agcgccgtca ggcctgacat tcccgccatg
    3201  gtcctggaga atgggtgcca ggagggcgtc gtcgcctcgg tccttgtcaa
    3251  gagagcctcc ggcgagatgc ttgccctggc tgtcaggatg ggttcacagg
    3301  ccgccatcaa gattggtagt gccgttgtgc atgggcaaac tggcatgctc
    3351  ctgactggct ctaatgccaa ggcccaggac ctcgggacca tcccgggcga
    3401  ctgtggctgt ccctatgttt ataagaaggg taacacctgg gttgtgattg
    3451  gggtgcacgt ggcggccact aggtctggta acacagtcat tgccgccact
    3501  cacggagaac ccacacttga ggctctggag ttccagggac cccccatgct
    3551  tccccgcccc tcaggcacct atgcaggcct ccccatcgcc gattacggcg
    3601  acgctccccc cttgagcacc aagaccatgt tctggcgtac ctcgccagag
    3651  aagcttcccc ctggggcttg ggagccagcc tatctcggct ctaaagatga
    3701  gagggtggac ggtccttccc ttcagcaggt catgcgagat cagcttaagc
    3751  cctattcaga accacgcggt ctgcttcccc ctcaagaaat ccttgatgca
    3801  gtctgcgacg ccattgagaa ccgccttgag aacacccttg aaccacagaa
    3851  gccctggaca tttaagaagg cttgtgagag cttggacaag aacaccagta
    3901  gtgggtatcc ctatcacaag cagaagagca aggactggac ggggagcgct
    3951  tttattggcg atcttggtga ccaggccacc cacgccaaca acatgtatga
    4001  gatgggtaaa tccatgcgac ccatttatac agctgccctc aaggatgaac
    4051  tggttaagcc agacaagatc tacgggaaga taaagaagag gcttctctgg
    4101  ggctctgacc ttggcaccat gattcgcgct gcccgtgctt ttggcccttt
    4151  ctgtgatgct ctgaaagaaa cctgcatttt caaccccatc agagtgggca
    4201  tgtcgatgaa cgaagatggc cccttcatct tcgcaagaca cgccaatttc
    4251  aggtaccaca tggatgctga ctataccagg tgggactcca cccaacagag
    4301  agccatccta aagcgcgctg gcgacatcat ggtgcgcctc tcccctgagc
    4351  cagacttggc tcgggttgtc atggatgatc tcctggcccc ctcgctgttg
    4401  gacgtcggcg actataagat cgttgtcgag gaggggctcc catccggctg
    4451  cccttgcacc acacagctga atagtttggc tcactggatt ttgacccttt
    4501  gtgcaatggt tgaggtaacc cgagttgacc ctgacattgt gatgcaagaa
    4551  tctgagttct ccttctatgg tgatgacgag gtggtttcga ccaacctcga
    4601  gttggatatg gttaagtaca ccatggcttt gaggcggtac ggtctcctcc
    4651  cgactcgcgc ggacaaggag gagggacctc tggagcgtcg ccagacgctg
    4701  cagggcatct ccttcctgcg ccgtgcgata gttggtgacc agtttgggtg
    4751  gtacggtcgt cttgatcgtg ccagcatcga ccgccagctc ctctggacta
    4801  aaggacctaa ccaccagaac ccctttgaga ctctccctgg acatgctcag
    4851  agaccctccc aactaatggc cctgctcggt gaggctgcca tgcatggtga
    4901  aaagtattac aggactgtgg cttcccgtgt ctccaaggag gccgcccaaa
    4951  gtgggataga aatggtagtc ccacgccacc gatctgttct gcgctgggtg
    5001  cgctttggaa caatggatgc tgagaccccg caggaacgct cagcagtctt
    5051  tgtgaatgag gatgagtgat ggcgcagcgc caaaagccaa tggctctgag
    5101  gccagcggcc aggatcttgt tcctgccgcc gttgaacagg ccgtccccat
    5151  tcaacccgtg gctggcgcgg ctcttgccgc ccccgccgcc gggcaaatta
    5201  accaaattga cccctggatc ttccaaaatt ttgtccagtg cccccttggt
    5251  gagttttcca tctcgcctcg aaacacccca ggtgaaatac tgtttgattt
    5301  ggccctcggg ccagggctta acccctacct tgcccacctc tcagccatgt
    5351  acaccggctg ggttgggaac atggaggttc agctggtcct cgccggcaat
    5401  gcctttactg ctggcaaggt ggttgttgcc cttgtaccac cctattttcc
    5451  caaggggtca ctcactactg cccagatcac atgcttccca catgtcatgt
    5501  gtgatgtgcg caccctggag cccattcaac tccctcttct tgatgtgcgt
    5551  cgagtccttt ggcatgctac ccaggatcaa gaggaatcta tgcgcctggt
    5601  ttgcatgctg tacacgccac tccgcacaaa cagcccgggt gatgagtctt
    5651  ttgtggtctc tggccgcctt ctttctaagc cggcggctga tttcaatttt
    5701  gtctacctaa ctccccccat agagagaacc atctaccgga tggtcgactt
    5751  gcccgtgata cagccgcggc tgtgcacgca cgcacgttgg cctgccccgg
    5801  tctatggtct cttggtggac ccatccctcc cctcaaatcc ccagtggcag
    5851  aatggaaggg tgcacgttga tgggaccctg cttggtacca ccccaatctc
    5901  cggttcatgg gtgtcctgct ttgcggcgga ggctgcctat gagttccaat
    5951  cgggcaccgg tgaggtggcg acattcaccc tgattgagca ggatggatct
    6001  gcctacgtcc ccggtgacag ggcagcacca ctcggttacc ccgatttctc
    6051  tgggcaactg gagatcgagg tccagaccga gaccaccaag actggagaca
    6101  agctcaaggt caccactttt gagatgattc ttggcccaac gaccaacgcg
    6151  gaccaggccc cctaccaggg cagggtgttc gccagcgtca ctgctgcggc
    6201  ctctcttgac ttggtggatg gcagggttcg tgcggtccca agatccatct
    6251  acggttttca ggacaccatc cctgaataca acgatgggct actggttccc
    6301  cttgcccccc caattggtcc ctttctcccc ggcgaggtcc tcctgaggtt
    6351  ccggacctac atgcgtcaga tcgacaccgc tgacgccgca gcagaggcga
    6401  tagactgtgc actcccccag gagtttgtct cctggttcgc gtctaacgcg
    6451  ttcaccgtgc agtccgaggc cctgctcctt agatacagga acaccctgac
    6501  tgggcaactg ctgttcgagt gcaagctcta caacgaaggt tacatcgcct
    6551  tgtcttattc cggctcagga cccctcacct tcccgaccga tggcatcttt
    6601  gaggtcgtca gttgggttcc tcgcctttac caattggcct ctgtgggaag
    6651  tttggcaaca ggccgaatgc tcaaacaata atggctggtg ctctttttgg
    6701  agcgattgga ggtggcctga tgggcataat tggcaattcc atctcaaatg
    6751  ttcaaaacct tcaggcaaat aaacaattgg cagctcagca atttggttat
    6801  aattcttccc tgcttgcaac gcaaattcaa gcccagaagg atctcactct
    6851  gatggggcag caattcaacc agcagctcca aaccaactct ttcaagcacg
    6901  acttggaaat gcttggcgct caggtgcaag cccaggcgca ggcccaggag
    6951  aacgccatca atatcaaaac ggcgcagctc caggccgcag gcttttcaaa
    7001  gacggatgcc gcacgccttg ccttggggca gcagcccacg agggccgtgg
    7051  attggtctgg gacgcggtac tacaccgcta accagccagt cacgggcttc
    7101  tcgggtggct ttaccccaac ctacactcca ggtaggcaag tgacatcccg
    7151  ccctgtggac acatcccctc taccgatctc gggtggacgc ttgccctccc
    7201  ttcgtggagg ttcctggtcc ccgcgcgacc atacgccggc gactcaaggc
    7251  acctacacga acggacggtt cgtgtctctc cctaagatcg ggagtagcag
    7301  ggcataggtt ggaagagaaa ccttttgtga aaatgatttc tgcttactgc
    7351  tttcttttct ttgtggtagt tagatgcatt tt