Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2, complete genome.

ACC No: DQ286725

Dated: 2009-12-06 | Length: 16535 | CRC: -1607329366

                ID   DQ286725; SV 2; linear; genomic RNA; STD; VRL; 16535 BP.
XX
AC   DQ286725;
XX
DT   05-DEC-2005 (Rel. 86, Created)
DT   06-DEC-2009 (Rel. 103, Last updated, Version 5)
XX
DE   Grapevine leafroll-associated virus 2, complete genome.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-16535
RA   Angelini E., Bertazzon N., Borgo M.;
RT   "Genome sequence of grapevine leafroll-associated virus 2 strain BD";
RL   Unpublished.
XX
RN   [2]
RP   1-16535
RA   Angelini E., Bertazzon N., Borgo M.;
RT   ;
RL   Submitted (10-NOV-2005) to the EMBL/GenBank/DDBJ databases.
RL   Biologia e Difesa, CRA Istituto Sperimentale per la Viticoltura, Viale
RL   XXVIII Aprile, 26, Conegliano, (TV) I-31015, Italy
XX
RN   [3]
RC   Sequence update by submitter
RP   1-16535
RA   Angelini E., Bertazzon N., Borgo M.;
RT   ;
RL   Submitted (04-DEC-2009) to the EMBL/GenBank/DDBJ databases.
RL   Biologia e Difesa, CRA Istituto Sperimentale per la Viticoltura, Viale
RL   XXVIII Aprile, 26, Conegliano, (TV) I-31015, Italy
XX
CC   On Dec 4, 2009 this sequence version replaced gi:82780726.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .16535
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /isolate="BD"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy"
FT                   /isolation_source="Vitis vinifera cv. Don Mariano"
FT                   /db_xref="taxon:64003"
FT   gene            107. .8917
FT                   /gene="ORF1a"
FT   CDS             107. .8917
FT                   /codon_start=1
FT                   /gene="ORF1a"
FT                   /product="methyltransferase/helicase polyprotein"
FT                   /db_xref="GOA:Q2V8A8"
FT                   /db_xref="InterPro:IPR000606"
FT                   /db_xref="UniProtKB/TrEMBL:Q2V8A8"
FT                   /protein_id="ABB90531.2"
FT                   /translation="MSSLAISSLPSMVAQLSFGQPAATVAKSLIMASLPSLQTCFTQSE
FT                   FSSLFICLVSFQKIKMFQSFLSSVCDLSLFSELSTFGFCREFIRLGGGAHPLFVVSFQS
FT                   GPLSVSLGCVNGVFALLNISFPFLKAASLLTGVEGVVERPRVRISKREKQLNKRAFSIA
FT                   RAAARNKRSKVGPKEVRASHVLPLPSGRFRFSQNKNKTELIILSEKVGVLARVKCTAPV
FT                   VRRRVSGSFITHIPLIAVSPFGVKYRCFAPSCGANACFKRKLARRVVVNDSRAEKLHSK
FT                   RRLKVLLQNFNSRSAKKVRVTPTPRVEDVADKVVQPRVIFFGSFPTPFPVVTPPEIVKA
FT                   VHKEEPEPEARVPSAPAKKIDHRARENATKTTVTVPPRREAPTPSVAKRRDAIVISGVV
FT                   HEVINKIRDGMLRFRVGGDMRFSRFFSSTHGCKIIANVRTNTSVWLNCTKVNGEKFSLA
FT                   VPCSVDYVAMLRYASGGKFPFVLMSRERYPEGRCYLAHLRYLCAFYCQSFRESDFSLGS
FT                   WPSVARLKGVILKRFGEEALKLGVRGYYVSRNAFHCDYDSAYVRSLNRIVGYVGGVEVI
FT                   PSTLVSTVALKVGERACDRPKSILFGSIRCELRYTESIDPGAPLSREKMNPKVTGTRKI
FT                   LRADEGGTAIPSAKVNQAHRYNARVDKRFSLFLAGSVNAVMKKVAAGVLRYRVGGDMDF
FT                   HNSFTTQAGYHILVRRKKSSSVRVELWSPIGKFSRHHVLPLSRDYAAMLSSLRAVVSLL
FT                   VFMTRNKYKNGYCYLAHCRYASAFMLKGFHPAAFDIGAFPTAARLRSRMVSILGERCLS
FT                   LNLYGSFTSRGVFHCDYDAGYVKDLRFLSAIIAGKEETGEVVASDITPAMKQKTIEAVY
FT                   DRLYGSNDSLLKLSIEKDLIDFKNDVQSLKKDRPVIKVPFYMSEATQNSLTRFYPQFEL
FT                   KFSHSTHSDHPAAAASRLLENETLVRLCGHSVSDIGGCPLFHLNSKTQRRVHVCRPVLD
FT                   GKDAQRRVVRDLQYSSVRSGEDDKLLDGPSNVDVCHHPLGACDYESSAMMMVQVYDASL
FT                   YEICSAMIKKKARITYLTMVTPGEFLDGRECVYMESLDCDIEVDVHADVVVYKFGSSCY
FT                   SHKLSTIKDIMTTPYLTLGGFLFSVEMYEIRMGVNYFKITKSEVSPNISCSKLLRYRRA
FT                   NSDVVKVKLPRFDKKRRMCLPGYDIIYLDSKFVSRVFDYVVCNCSAVNSKTFEWVWSFI
FT                   KSSKSRVIISGKIIHKDVNLDLKFVESFAAVMLASGVRSRLASEYLAKNLSHFSGDCSF
FT                   IEATSFVLREKIRNMTMNFNECLLRLVKRVAFATLDVSFLDLDATMESITDFAECKVAV
FT                   ELEELGCLRANAENDKIRNLAGDSLAAKLASEIVVDIDAKPISKRADHSRSDTCEKKDV
FT                   PKPGLRGGSRNGVIKEFIDFILSSASRLFSCIADQQRIKTYVHYLDVAVSFLDENYENV
FT                   SFILRVLSKGFSSMFSHLATRGSLTSRLTSAVQAVRDIAAFCANVSISKAKVVITFSAA
FT                   ICAMMFNGCGFSGDGREYKSYMHRYTQVLFDTIFFEDKSYIPIELLSSAICGSIVTLFS
FT                   SGTSVSLNAFLLQIAKGFSLELIVRNVVRVTHSLSTTATDGVMRSIFSQIISHLLVGNT
FT                   SNLAYQIAFLTGVVPLLVKKCVSLIFSKSEDTYSGFIKHGVSEFSFISNILKYLRGKLV
FT                   DELKAVVQGVFESNKHLFRDVTQEAIRSSVMQIPTAVVDGLRCAASRVYNGIVGARKGP
FT                   EGGGSHGSDDDRDEYFSCDESETPGLKGGSRSGFSILSFFSRIMQRARLLVRRVKHECF
FT                   SKIFESVSFKIHELRNFFFGKKRSDVGVYEYLSEDIAEALSSLEKCDEIESLIGDGFSD
FT                   VADDSLADLNYFDFSEDFLASVEDLPRAGLRGGGAKVGMLAVLNYIFESLRVITRNVSN
FT                   SSNLISSVVFSRGIYDRIRSVFPNRKAFVTIVREYVQRLLKDRMRSLGLSNEHVVSSFA
FT                   EMVPLLLRDKLSGTFLDRAISSLKWWSETCLSADRREKLFALACIVVLGFPFFIRYIGG
FT                   VACDNLLSSFRRLSDRLKVIFKRWCDAVAFGYHRLFHCDEDGDSTSSGLKGGGSQSFLW
FT                   CLLMRMSRLALSLSWAGCKCVYSHYNIFLLCVSLVEEVNVIARVVGGFSFISRPVSSVL
FT                   ALLLLQPERCVDYSGKLATAFSFLFGISPRVPLLVKKFFEWITRSSLLKSIRRFLRVVA
FT                   VKLNLRKKRGLGAKGGGYPCQRAVPVIPSNRTMVDERERLSVKMQGVEALRSELRILED
FT                   LDAAVVEKLNQRRNRETDDNEFSQPAHESVQEVTSFCSKANSVGTALERAVLVEDAVKS
FT                   EKLTRMAKDLVRGGTVSDEIRTDALSDDEAVEELSITEERDDSPKTVRVSEYLNRLNSS
FT                   FEFPKPIVVDDNKETGGLTNAVREFYYMQELALFEIHSKLCAYYDQLRIVNFDRSMAPC
FT                   NEDAQLYVRKSGSTIVQGKDVRLNIKDFHDHDFLFDGKISLNKRRRSGNVLYHDNLSFL
FT                   ASNLFLAGYPFSRSFVFTNSAVDILLYEAPPGGGKTTTLIDSFLKVFKKGEVSTMILTA
FT                   NKSSQVEILKKVEKEISNIECQKRKDKRTPKKSIYTIDAYLMHHRGCDADILFIDECFM
FT                   VHAGSVLACIEFTRCHKVMIFGDSRQIHYIERNELDKCLYGDLDRFVDLQCRVYGNVSY
FT                   RCPWDVCAWLSVVYDNVIATVKGESEGKSSMRINEINSVDDLVPDVGSTYLCMLQSEKL
FT                   EISKHFVRKGLTKLNVLTVHEAQGETYARVNLVRLKFQEDEPFKSIRHITVALSRHTDS
FT                   LTYNVLAARRGDATCDAIQKANELVNKFRVFPTSFGGSVISLDVQKDVEDNSRCKASSA
FT                   PLSVINDFLSDVNPGTTVIDFGDLSADFSSGPFECGASGIVVRDNISSSNITDHDKQRV
FT                   "
FT   gene            9033. .10295
FT                   /gene="ORF1b"
FT   CDS             9033. .10295
FT                   /codon_start=1
FT                   /gene="ORF1b"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /db_xref="GOA:Q2V8A7"
FT                   /db_xref="InterPro:IPR001788"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:Q2V8A7"
FT                   /protein_id="ABB90532.1"
FT                   /translation="MFGEAMAMNCVRRCFDLEAFSSLRNDVISITRSGIEQWMEKRTPS
FT                   QIKALMKDIESPLEIDDEICRFKLMVKRDAKVKLDSSCLTKHSAAQNIMFHRKSINAIF
FT                   SPIFNEVKNRIMSCLKPNIRFFTEMTNRDFAAVVSNMLGDDDVYHIGEVDFSKYDKSQD
FT                   AFVKSFEEVMYKELGVDEELLAIWMCGERLSLANTLDGQLSFTIENQRKSGASNTWIGN
FT                   SLVTLGILSLYYDVRKFEALYISGDDSLIFSRDKISNYADDICADMGFETKFMSPSVPY
FT                   FCSKFVVMCGHKTFFVPDPYKLFVKLGAVKEDVSMDFLFETFTSFKDLTSDFNDERVIQ
FT                   KLAELVALKYDVQSGNTTLALSVIHCLRSNFLSFSKLYPRVKGWQVFYTSVKKALFKSG
FT                   CSLYESYITPFGQAVMVWEDE"
FT   gene            10384. .10554
FT                   /gene="ORF2"
FT   CDS             10384. .10554
FT                   /codon_start=1
FT                   /gene="ORF2"
FT                   /product="6 kDa protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2V8A6"
FT                   /protein_id="ABB90533.1"
FT                   /translation="MDQVLQFECLYLLNQAVFAITFVFILLIIRVIKSFRRSAHEVSNT
FT                   TVRGGGFSTVV"
FT   gene            10565. .12364
FT                   /gene="ORF3"
FT   CDS             10565. .12364
FT                   /codon_start=1
FT                   /gene="ORF3"
FT                   /product="heat shock 70-like protein"
FT                   /db_xref="GOA:Q2V8A5"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2V8A5"
FT                   /protein_id="ABB90534.1"
FT                   /translation="MVVFGLDFGTTFSTVCVYKDGKVYSYKQNNSAYIPTYLYLFSETN
FT                   NMVFGYEAESLMHNAKVKGSFFRDLKRWVGCDSSNFGEYFDRLKPHYSVRLLKIGSGLN
FT                   DTVALGNYGGTVRSEVHLPGLIASFIKAIISCAEDAFACACTGVICSVPANYDSVQRNF
FT                   TDQCVSLSGYQCVYMVNEPSAAALSACNLINKRSANLAVYDFGGGTFDVSIISYRNNTF
FT                   VVRASGGDLNLGGRDVDRAFLNHLFSLTSLEPDLSLDISNLKESLSKTDAEIVYTLKGA
FT                   DDKKEDVRVNKSILTAVMLPYVNRTLKILESTLKSYAKNMGGMRNVKCDLVLIGGSSYL
FT                   PGLEDILSKHRQVDRILKVSDPRAAVAVGCALYSSCLSGSQGLLLIDCAAHSISIADMS
FT                   CHQIICAPAGAPIPFSGTTPLYLARANKNSQRQIAVFEGEYIKCPKNRKICGSNIKFCD
FT                   IGVTSISYAPITFYLDVSISSVGAISFVVRGPEGKEVSLTGTPAYNFSSVILGTRSVRE
FT                   LHISLSNKVHLGLLLHRKADRRLLFTESETVRYVETVEVADVLKEFKSYSASSLPLDED
FT                   VEPLMGKSVQKILRGGRLEEIPI"
FT   gene            12291. .13904
FT                   /gene="ORF4"
FT   CDS             12291. .13904
FT                   /codon_start=1
FT                   /gene="ORF4"
FT                   /product="63 kDa protein"
FT                   /db_xref="InterPro:IPR004909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2V8A4"
FT                   /protein_id="ABB90535.1"
FT                   /translation="MSNHSWESLFKKFYGEADWKKYLSKSIAAHSADVKNLPDTQLYGG
FT                   RIVKKSDFESAAPRSFEQELGLFILSERDVGWGKMCGMTVEEAAYQLTNPNAFPIVAEK
FT                   CDPDVKTEGQKYSMEDVENFMRLSNLDTSDRTLVEQCWSLSNSCGVLINPDDKERFVSL
FT                   TFKNNELINDSSNANIDCRVSDYLVYAMSLFNQRAQKSQAGNISLYEKYCAHIRKYLES
FT                   TDLFFTSPDRIPLLTGILYDFCKEYSVFYSTYKRNVDNFRFFLANYMPLISDIFVFQWL
FT                   KPAPDVRLLFDISAAELTLEVPTLSLVDSQVVIGHILRFVESYTADPAIDALEEKLDAI
FT                   MKLDNPHLSTAQLWVGFFCYYGEFRTAQHRVVPRPDVYKTPESVGGFEINMKNVERFFD
FT                   KLQRELPSVSLRRQFNGARAYEAFKVFKGGNISFKPISRLNIPREFWYLNVDYFRHANR
FT                   SGLSDEEILILNNISIDVRKLCAERACSTLPSAKRFSKGHKSSVPSPRQERKVRDPLIT
FT                   LRNSLYEFQHRNSDRRFRLS"
FT   gene            13858. .14529
FT                   /gene="ORF5"
FT   CDS             13858. .14529
FT                   /codon_start=1
FT                   /gene="ORF5"
FT                   /product="minor coat protein"
FT                   /db_xref="GOA:Q2V8A3"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q2V8A3"
FT                   /protein_id="ABB90536.1"
FT                   /translation="MSSNIGIAIGGSDSLETSGFLLSTRKEAVDKFFNELRNENYSSVD
FT                   SSRLSDQEVKEVLEKSKESFKSELASTDDHFVYHIIFFLIRCAIISTSDKVKYVGSHKY
FT                   VVEGKTYTVNDNWVFNMMKGLTKQYKRVNGLRAFCCACEDLYLSVAPMMSERFKTKAIG
FT                   MKGLPAGKEYLGADFLSATSKLMGDHDRAVSIVAAKNAVDRSAFTGGERKIVSLYALGR
FT                   N"
FT   gene            14614. .15210
FT                   /gene="ORF6"
FT   CDS             14614. .15210
FT                   /codon_start=1
FT                   /gene="ORF6"
FT                   /product="major coat protein"
FT                   /db_xref="GOA:Q2V8A2"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q2V8A2"
FT                   /protein_id="ABB90537.1"
FT                   /translation="MELMSDENLSTLVITDASSLNGVDKKSLSAELIKMLVQRGAPAEG
FT                   IEVIFGMMLYAIAARTTSPKVQRGDSDVLFSYGSGDRTITVTEGDLKKVLDGFAPLTRF
FT                   TNKLRTMGRTFTEAYIDFCVAYKHKMPQLNAAAELGIPAEDSYLAADFLGACPKLSELQ
FT                   QSRKMFASMYALKTEGGVVSTPVSNLRQLGRREVM"
FT   gene            15210. .15695
FT                   /gene="ORF7"
FT   CDS             15210. .15695
FT                   /codon_start=1
FT                   /gene="ORF7"
FT                   /product="19 kDa protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2V8A1"
FT                   /protein_id="ABB90538.1"
FT                   /translation="MEICTQNSESLVLLRTTQNTILLVIKSDGKVNLPKILICGYLRVS
FT                   CHGDVTGCCREDIVKDFEGAHHTVIRSTTIQYDYESTAKEYNDSHCVVKFFLETGDVFW
FT                   FFLRSDSRGRAARHLRTFFEANNFFFGSHCGTMEHCLKQVLIETESVIDSFCEERNR"
FT   gene            15697. .16311
FT                   /gene="ORF8"
FT   CDS             15697. .16311
FT                   /codon_start=1
FT                   /gene="ORF8"
FT                   /product="24 kDa protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q2V8A0"
FT                   /protein_id="ABB90539.1"
FT                   /translation="MKVIVSPYEAEDILARSTDMLRNIDSGVLDMKECIKVFSTITREV
FT                   HCAKTSYQWCVDTGLYQRDCAEKRLIDTIESNLRIAQPLVREKVANHLCKDEPRELVAF
FT                   ITRKYVKLTGVPIREAVKIEMRSLSKTVLNKLSLEMAFYMSPRAWKHAEWLDLKYTPLK
FT                   IYRDLLLDVNTLNALCEEDDVHVVINKDEDGDHDLDLQEDC"
XX
SQ   Sequence 16535 BP; 4229 A; 3390 C; 4198 G; 4718 T; 0 other;

dq286725 Length: 16535  06-DEC-2009  Type: N  Check: 6631  ..

       1  atattctgtt ggctttcacc tgtgtttgtg ccttggttca atcacaacct
      51  gaaagtttca gttcccggga atatcggttt tttctcagaa accttttttc
     101  tccagaatgt ctagcctcgc tatctcttct cttccctcga tggttgctca
     151  actgagtttt ggtcagcctg ctgccacggt tgccaagtca ttaattatgg
     201  cttcccttcc gtccctccag acttgcttca ctcagagtga gttttcctct
     251  ctttttattt gtttggtttc tttccaaaaa ataaaaatgt ttcaatcttt
     301  cctaagttca gtgtgcgatc tttctctctt ttctgaactt tccacttttg
     351  gattctgtcg tgaattcatt cgtttaggag gtggtgctca tcctcttttt
     401  gtcgtttcct tccagagcgg acccttgtcc gtcagtttgg ggtgtgtgaa
     451  tggtgttttt gcacttctga acatttcttt tccctttttg aaagctgcgt
     501  cactgttgac gggtgttgaa ggcgtggtcg aaagacctag ggtaagaatt
     551  tccaagcgag agaagcagtt gaataaacgc gctttttcga tagctcgcgc
     601  tgctgcgcgt aacaagcgtt ccaaggttgg acctaaggag gttcgtgcgt
     651  ctcacgtgct gcctcttcct agtggtcgtt ttcgtttttc ccagaataaa
     701  aacaaaacag aattaatcat actatctgag aaggtaggcg tcctagcgcg
     751  cgtgaagtgc acagcgccgg tggtgcgacg tcgcgttagc ggcagtttta
     801  tcacccacat acccctaata gcggtttcac cgttcggggt gaagtaccgt
     851  tgtttcgcac cttcttgcgg cgccaacgcg tgcttcaagc gcaagctcgc
     901  tcgtcgtgtg gttgtgaatg atagccgcgc cgaaaagctc cactcgaaaa
     951  ggcgtctgaa ggtgttattg caaaatttta acagccgatc agcaaagaag
    1001  gtgcgcgtca cacccacgcc gcgcgttgaa gacgttgcgg ataaggtcgt
    1051  ccagccgcgc gtcatcttct tcggcagctt tcccactccc tttcccgtgg
    1101  tgacaccacc ggaaatcgta aaggcggtgc ataaggaaga accagagccg
    1151  gaagcgcgcg ttcccagtgc ccccgcgaag aaaattgatc atcgtgcgcg
    1201  tgagaacgca acaaaaacca ccgtaacggt acctcctcgg cgcgaagccc
    1251  caaccccgag cgtcgcgaag cgtcgtgatg cgatcgtcat ttcgggcgtg
    1301  gtgcatgaag taataaacaa gatcagggat ggcatgctac gatttcgcgt
    1351  gggaggcgac atgcgttttt ctaggttctt ttcgtcgaca cacggctgta
    1401  agatcatcgc caatgtgcgc actaatactt cggtatggtt gaattgcact
    1451  aaagttaatg gcgaaaaatt ttcattggcg gttccatgtt cggtggatta
    1501  cgtggcgatg ttgcgctacg cgagtggcgg gaaattcccg tttgtgttga
    1551  tgagcaggga acgctatcct gagggacgtt gctacttggc tcatctgagg
    1601  tacctgtgcg ctttctattg tcaatccttc agggaatcgg atttctcctt
    1651  gggttcgtgg ccctcggttg cgcggctcaa aggggtaatc ttgaagcgct
    1701  tcggtgaaga agcgctaaaa ttgggtgttc gcggttatta cgtctctcgt
    1751  aatgcttttc actgcgatta cgactcagcg tatgtgagga gtctaaatag
    1801  aattgtgggg tatgtcgggg gagttgaggt tattccttcg acgttagttt
    1851  ctacggttgc gttgaaagtg ggcgagcgcg cttgtgatcg tccgaagagt
    1901  atactctttg gatctattcg atgcgagtta cgctacaccg aatcgattga
    1951  tcctggagcg cctttatcgc gagaaaaaat gaatccgaaa gtgaccggaa
    2001  cccgtaagat actccgcgct gatgaaggag gtactgcaat tcctagtgcg
    2051  aaagtgaatc aggcacatcg ctataatgcc cgtgtcgata agaggttttc
    2101  gctctttttg gcgggtagtg ttaatgcggt gatgaagaaa gtcgccgctg
    2151  gagtgttgcg gtatcgcgta ggcggcgaca tggattttca caactctttc
    2201  actacgcaag cgggttatca catattggtg cggcgtaaaa agagtagcag
    2251  cgttcgcgta gaactttggt caccgatcgg aaaattttcg cgtcatcacg
    2301  tcctcccctt gtcaagagac tacgcggcga tgttatcttc gctgcgggcg
    2351  gtcgtttccc ttttggtttt tatgacgagg aataagtata agaatggtta
    2401  ctgttattta gcccattgca ggtacgcgag tgcctttatg ttgaaaggtt
    2451  tccaccccgc tgccttcgat attggtgctt tccccacggc cgcgaggctc
    2501  aggtcgcgca tggtttcgat tcttggcgag aggtgtctaa gtttaaattt
    2551  gtacggttct tttacctctc gcggggtttt ccattgcgat tacgacgcgg
    2601  gttatgtgaa ggatttaaga tttttgtcag cgattatcgc cggtaaggaa
    2651  gagacaggag aggtagttgc ttccgacatc actccggcga tgaaacagaa
    2701  aactattgaa gccgtttacg acaggttata cggaagtaat gattcactat
    2751  tgaaattgag tatcgagaaa gacttgatag attttaagaa tgacgtgcag
    2801  agtttgaaga aagacagacc cgtcattaaa gttcccttct acatgtccga
    2851  agccactcaa aattcgctga cgcgcttcta tcctcagttt gagctgaagt
    2901  tttcacactc cacgcattcc gatcatcccg ctgccgccgc atcgaggtta
    2951  cttgagaatg agacgttggt gcggttgtgc ggtcatagtg tctccgatat
    3001  tgggggttgt cctcttttcc atctcaattc caagacgcaa agacgcgttc
    3051  atgtctgccg acccgtgttg gacggtaaag atgcgcagcg ccgcgtggtg
    3101  cgagatttgc agtactcttc cgtgcgttcc ggtgaggatg ataagctcct
    3151  ggacggacct tccaatgtag acgtgtgcca ccaccctctc ggcgcctgcg
    3201  attacgaaag tagtgccatg atgatggtgc aagtttatga cgcgtcgcta
    3251  tatgagatat gtagcgctat gattaagaag aaggctcgta taacttatct
    3301  caccatggtt actccgggcg agtttcttga cgggcgtgaa tgcgtctaca
    3351  tggaatcgct ggactgcgac atcgaagttg atgtacacgc agacgtagtg
    3401  gtgtacaagt tcggcagttc gtgctattct cacaagcttt cgaccattaa
    3451  ggatatcatg accacgccgt atttgacgtt ggggggattc ttatttagcg
    3501  tagagatgta tgaaatccgg atgggcgtga attattttaa aatcacgaaa
    3551  tcggaagtga gccccaacat ctcgtgctct aaacttctaa gatatcgaag
    3601  agccaacagc gacgttgtga aggtgaaatt accacgcttt gacaagaagc
    3651  gccgcatgtg tttacctggg tacgacatca tatatttaga ttcgaaattt
    3701  gtgagccgcg tttttgatta cgttgtgtgt aattgctcag cggtgaactc
    3751  gaagactttc gagtgggtct ggagtttcat taagtccagc aagtcgagag
    3801  tgatcatcag tgggaagatc attcataaag acgtcaacct cgatcttaag
    3851  ttcgtcgaga gctttgctgc tgtgatgctc gcttccggcg tgcgtagcag
    3901  gttagcctcg gagtacctgg caaaaaatct cagtcatttt tcgggtgatt
    3951  gctcctttat tgaggctaca tcgtttgtcc tacgtgagaa aattaggaat
    4001  atgactatga actttaacga atgccttctg cggttagtga aacgcgtggc
    4051  attcgctact ttggacgtga gtttcctgga tctagatgct accatggagt
    4101  cgatcacgga ttttgcggaa tgtaaagtgg ccgtggagct tgaagagtta
    4151  ggctgtttga gggcgaatgc tgaaaacgat aagattcgaa atctcgccgg
    4201  tgactcgctg gcagcgaagc tagctagtga aatagtggtc gatatagacg
    4251  ctaaacccat ctctaagcga gcggatcact cgaggagtga tacgtgtgag
    4301  aagaaagatg ttcctaagcc gggtttgcgt ggaggttcga ggaatggagt
    4351  tattaaagaa tttattgatt ttattttatc gtccgcgtcg cgcttgttta
    4401  gttgcatagc ggatcagcag cgcatcaaga cctacgtcca ctatcttgac
    4451  gtggccgtct ctttcctaga tgaaaattac gaaaatgttt cattcatttt
    4501  gcgggtcctc tctaaaggtt tctccagcat gttctctcat ctggctactc
    4551  gcggtagtct cactagtcgt ttaacgagcg cggtgcaagc cgttagagac
    4601  atagccgcat tctgcgccaa cgtgagcatc tctaaagcca aagtggtgat
    4651  caccttctct gcggccatat gcgcgatgat gttcaacggc tgtggtttct
    4701  cgggagatgg tcgagagtac aaatcgtaca tgcatcgtta tacgcaggtg
    4751  cttttcgata ccattttctt tgaagataaa agctatattc ctatagaatt
    4801  actaagctcc gctatatgtg gctcaatcgt tactctcttt tcgtccggaa
    4851  cgtccgtcag tttaaacgca ttcctgcttc aaatcgctaa ggggttctct
    4901  ttagaactta tcgttcggaa tgtggtgcgc gtgactcatt ccttgagcac
    4951  cacagcgacg gacggggtga tgcgcagtat cttctctcaa atcattagtc
    5001  acctgctcgt aggaaatact agtaatttag cttatcaaat agcctttttg
    5051  acgggggtgg tgcctctgct ggtaaagaag tgtgtgagtc tgatcttttc
    5101  gaagagtgaa gacacttact caggcttcat taaacacggg gtcagtgaat
    5151  tctctttcat cagcaacatt ctgaaatatc taaggggtaa acttgtggat
    5201  gagctaaaag cggtagttca aggggttttt gagtcaaata aacatctctt
    5251  ccgagatgtt actcaggaag cgatccgttc gtctgttatg caaataccca
    5301  ctgccgtggt cgatggtctg agatgcgcgg caagtagagt gtataatggc
    5351  atcgttggcg cgaggaaagg tccagagggc ggtggttcgc atggtagtga
    5401  tgacgaccgc gatgagtatt tttcttgtga tgagagtgaa actccaggtt
    5451  taaaaggtgg atcaagaagc ggtttctcaa ttttatcttt cttttctcga
    5501  attatgcagc gggcgcgcct tttagttcgt agggtgaaac acgagtgctt
    5551  ctcgaagatt ttcgaaagtg tttcatttaa gattcatgaa ctcagaaatt
    5601  tcttcttcgg gaagaagcga agcgatgttg gggtgtacga atatctatcg
    5651  gaagatattg ctgaagcttt atcgtcgctg gagaagtgtg acgaaattga
    5701  gagtctaatt ggagatggat tcagcgatgt cgcggatgac tctctcgcgg
    5751  atttgaacta cttcgacttc tcagaggatt ttttagcttc tgttgaggac
    5801  ctgccccgcg ccggattgcg cggtggcggt gcgaaagtgg ggatgctagc
    5851  tgttttaaat tacatatttg aatcactacg cgtcataacc aggaatgtgt
    5901  cgaacagttc gaatctcata tcttcggttg ttttctcgcg cggaatttat
    5951  gatagaatcc gtagtgtttt tccgaataga aaggctttcg taacgatcgt
    6001  gcgtgaatat gttcaaagac ttttaaagga tcgcatgcgt agtttagggt
    6051  taagtaacga acacgtggtg agttcttttg cggagatggt gccactactt
    6101  ctacgggata agttgtcggg gacgtttctg gatcgagcga tctcctcact
    6151  gaaatggtgg tcggaaactt gcctgtcggc tgatcgaaga gagaaactct
    6201  tcgctctcgc gtgtatagtc gtgttgggct ttccgttttt catacgttat
    6251  ataggcgggg tggcgtgtga taatcttcta tcatcttttc gacgattgtc
    6301  tgaccgattg aaggtgatct ttaagaggtg gtgtgatgct gttgcgttcg
    6351  gctatcatcg tttgttccat tgtgatgagg atggcgattc tacatcgagt
    6401  ggtttaaaag gtggaggctc gcaatcgttt ctttggtgcc tgttaatgcg
    6451  catgtcgcgt ctcgcgcttt ccttgagttg ggcaggttgt aagtgcgttt
    6501  actcgcacta caacatattc cttctttgcg tctcattagt cgaggaggta
    6551  aacgttatcg cgagagttgt cgggggtttc tcattcatct cgcggccggt
    6601  ttcttctgtg ctggcgctgc ttctccttca acccgaaagg tgtgtcgact
    6651  actccggaaa gttagccacg gcattttcgt ttcttttcgg aatctctccg
    6701  cgcgtaccac ttttagtgaa aaagtttttt gagtggataa cacgcagctc
    6751  tctgctaaag agtattcgaa ggtttcttcg cgtagttgca gtgaaactga
    6801  accttcgaaa gaagagaggt ctcggggcaa agggtggggg ttatccgtgc
    6851  caaagagctg tgccagtcat accatccaac cgaaccatgg tcgatgagcg
    6901  tgaaaggctg tctgtgaaga tgcagggagt ggaagctttg cgctccgaat
    6951  tgagaattct cgaggatctt gacgccgcgg tggtagagaa gcttaatcag
    7001  cgcaggaatc gcgaaacgga tgataatgaa ttttcgcaac cggcgcacga
    7051  gagcgtgcaa gaggtaactt cattttgctc gaaggcgaat tcggtgggta
    7101  cggctcttga aagagcggtg ctcgttgaag atgcggtgaa gtccgaaaaa
    7151  ttaacgagga tggctaaaga cttagttcgg ggagggactg tgtctgatga
    7201  aatccgcacc gacgctttat ctgacgatga agcggtcgaa gagctttcga
    7251  tcaccgaaga gcgagatgat tcacctaaga cggtgagggt gagcgagtac
    7301  ttgaatagac taaactcgag tttcgaattt cctaaaccga ttgtggtgga
    7351  tgacaataag gagactggag gtttgaccaa cgcggtgcgt gaattttatt
    7401  acatgcaaga attggctctc ttcgagatcc atagcaaact ttgcgcttac
    7451  tatgatcaat tgcggattgt gaattttgat cgctcgatgg ccccctgtaa
    7501  tgaggacgct caattgtacg tccgaaaaag cggttcaaca atagtgcagg
    7551  gtaaggacgt gcgtttgaac attaaagatt tccacgatca tgactttctc
    7601  ttcgacggta agatttcttt aaataagcgg cgacgctctg gaaatgttct
    7651  gtaccacgat aatctttcat tcttggcgag caatctattt ctagcggggt
    7701  accccttctc gcggagtttc gtatttacga actctgcggt ggatattctt
    7751  ctttacgaag ctcctcccgg aggtgggaag accaccactt tgatagattc
    7801  cttcttgaaa gtgttcaaga aaggagaggt gtccaccatg atattaacgg
    7851  cgaataaaag ttcgcaagtt gagatactga agaaagtgga gaaggaaatc
    7901  tctaacatcg agtgccaaaa acgtaaagat aagaggactc cgaagaagag
    7951  tatatacacc attgatgcgt acttgatgca tcaccgaggt tgtgacgccg
    8001  acatactctt tatcgatgaa tgttttatgg ttcatgcggg cagcgtgctg
    8051  gcatgcattg agttcactag atgtcataaa gtcatgattt ttggggatag
    8101  tcgacagatt cattacattg aaagaaatga gcttgataag tgtctttacg
    8151  gagatcttga taggttcgtg gacctgcaat gtcgtgttta cggtaacgtg
    8201  tcctatcgtt gtccgtggga tgtctgcgct tggttgagcg ttgtttacga
    8251  taacgtgatt gccactgtca aaggcgagag tgagggaaag agcagtatgc
    8301  gcatcaatga aattaactcg gtggacgatt tagtccccga tgtagggtct
    8351  acttatttgt gcatgcttca gtccgaaaaa ctggaaatta gcaaacattt
    8401  tgttcgtaaa gggctaacta aacttaacgt tttaaccgtg cacgaggctc
    8451  aaggcgaaac atacgcgcgt gtgaacctag taaggttgaa atttcaggag
    8501  gacgaacctt tcaaatccat tagacacata accgtcgcgt tgtctcggca
    8551  caccgatagt ttgacttaca acgttttggc cgctcgaagg ggtgatgcta
    8601  catgtgacgc tatacaaaag gctaatgagt tggtgaacaa gtttcgtgtt
    8651  ttcccaacat ctttcggtgg tagcgtcatc agtcttgatg tccagaagga
    8701  tgtggaagat aatagtaggt gtaaggcttc gtcggcgcct ttgagtgtga
    8751  taaatgattt cttaagcgac gtaaatcccg gcaccaccgt gattgatttc
    8801  ggtgatctct cagccgattt cagctcggga ccttttgagt gcggtgccag
    8851  cggtatcgtt gtgcgagaca acatctcctc cagcaacatc actgatcacg
    8901  ataagcagcg tgtttagcgt agtgcggtcg caggcgattc cgcgaagaaa
    8951  gccatccttg caagagaatc tttattcttt tgaagcgcgg aattacaact
    9001  tctcgacttg cgaccgcttt acttcagctt cgatgtttgg tgaggcgatg
    9051  gctatgaact gcgtgcgccg ttgttttgat ctagaagctt tctcttcttt
    9101  gcgcaacgac gtgatatcta tcacacgatc gggtatcgag caatggatgg
    9151  agaagcgcac tcccagtcaa ataaaggctt taatgaaaga cattgaatcg
    9201  ccgctagaaa ttgatgatga aatttgcagg ttcaagttga tggtgaaacg
    9251  tgacgctaag gtgaaactag attcttcttg cttaaccaag catagtgccg
    9301  ctcagaatat tatgttccat cgtaaaagca tcaacgcgat tttttcaccc
    9351  atttttaatg aggtgaagaa tcgcatcatg agttgcctta aaccgaacat
    9401  aagatttttt acggagatga ctaacaggga ctttgctgcc gttgtgagca
    9451  acatgctcgg tgacgacgat gtttatcata ttggcgaagt ggatttttcg
    9501  aagtacgata agtctcaaga cgcattcgtg aagtcttttg aggaagttat
    9551  gtataaggaa cttggggtcg atgaagaact cctggcgatc tggatgtgcg
    9601  gcgaaaggct ttctctcgcg aacacgctag atggtcaatt gtccttcact
    9651  atcgagaatc agcgaaagtc aggcgcttca aacacatgga tcggtaattc
    9701  tctcgtcact ctaggtatat taagtcttta ctacgacgtg agaaaatttg
    9751  aagctttata catttcgggc gacgactcgt tgatcttttc gcgtgataaa
    9801  atatccaatt acgctgatga tatctgtgct gacatgggtt tcgaaacgaa
    9851  attcatgtcc ccgagcgttc cttacttctg ctccaagttc gttgttatgt
    9901  gtggacacaa gactttcttt gttcctgatc cgtataagct gttcgtgaaa
    9951  ctgggagcgg tgaaagaaga tgtctctatg gatttccttt tcgaaacttt
   10001  cacctccttt aaagatctga cttccgactt taacgacgaa cgcgtgattc
   10051  agaaacttgc cgaactcgtc gctctcaagt acgacgttca gagtggcaac
   10101  accactctag cgttgagcgt catacattgt ctgcgttcaa actttctttc
   10151  tttcagcaag ctataccctc gcgtgaaagg atggcaggtt ttttatactt
   10201  ctgttaagaa agcgctcttt aaaagcgggt gttcgctcta cgagagttac
   10251  attactccgt tcggccaggc agtcatggtg tgggaagatg agtagcgctt
   10301  tttcggcgtt gttatccatt gttgtccaca gctgtggtgc gattgcatga
   10351  cgtacacatt gtgtgtcatc gtgtaaatat cttatggacc aggttttaca
   10401  gtttgagtgt ttgtacttgc tcaaccaagc tgtttttgcc ataactttcg
   10451  tctttatcct gctgatcatt cgcgtgatca aatcttttcg cagaagcgca
   10501  cacgaggttt cgaacacgac cgtccgtggt ggaggtttct caaccgttgt
   10551  gtgatcttta cgaaatggtt gttttcggtt tagacttcgg cacgactttt
   10601  tcaactgtct gcgtgtacaa ggatggtaaa gtttactcat ataagcaaaa
   10651  taactccgcg tatattccga cgtacctcta cctgttctct gagaccaaca
   10701  acatggtttt cggttatgaa gccgaatcac tgatgcacaa tgcgaaagta
   10751  aaaggctcgt tctttaggga cttaaaacgt tgggtgggtt gtgattcaag
   10801  taactttgga gaatacttcg atcgcttgaa accgcactac tccgttcgtc
   10851  tgctaaaaat aggttctggc ttgaatgata cagttgctct cggaaattac
   10901  ggaggtaccg tccggtctga agtgcactta ccggggttga tagcctcgtt
   10951  tattaaagcg attattagtt gcgccgaaga cgctttcgct tgtgcgtgta
   11001  cgggcgtgat atgttcggtg cccgccaatt acgatagcgt gcaaaggaat
   11051  ttcaccgacc aatgcgtttc tttgagtggt tatcaatgcg tgtatatggt
   11101  caacgaacca tcagcagcag cgttatcagc ttgcaattta atcaataaga
   11151  gatcagcgaa tctggcggta tacgattttg gtggtggaac ttttgacgtg
   11201  tccatcattt cttaccgcaa caacacgttt gtggtgcgcg cttccggggg
   11251  agacctgaat ctgggcggaa gagatgtgga cagagccttt ttaaaccacc
   11301  ttttttctct tacttcatta gaacccgatc tatcgttaga catttcgaat
   11351  ctaaaagagt cgctatcgaa aactgatgcg gagatcgtct acactttaaa
   11401  aggggctgat gataaaaagg aggatgttag ggtgaataaa agtattctta
   11451  cggcagttat gctcccttac gtgaatagaa ctctaaaaat cttagaatct
   11501  actttaaagt cgtacgcgaa aaacatgggt gggatgcgca atgttaagtg
   11551  cgatttagta ctgattgggg ggtcttctta tcttcccggt ctggaggaca
   11601  tcctgtcgaa acaccgacaa gttgatcgaa tactaaaagt ttccgaccct
   11651  cgagcagcag tcgcggtcgg ttgtgcgctg tactcatcgt gcctctcggg
   11701  ttcacagggg ttgttactga tcgattgcgc agctcacagt atctcgatag
   11751  cggacatgag ctgtcaccag atcatttgcg ctccggctgg agctcccatt
   11801  ccgttctcgg gtactacacc tctatactta gctagagcta acaagaactc
   11851  gcaacgtcaa attgcagtgt tcgaaggtga atatataaaa tgtcccaaaa
   11901  acagaaaaat ctgtgggtcg aacataaaat tctgcgacat tggcgtgacg
   11951  agcatctcgt acgcgcctat caccttctat ctggatgttt cgatctctag
   12001  tgtgggcgcc atttcatttg tggtgagagg ccccgaagga aaagaagttt
   12051  ccttgacggg cactcccgct tacaatttct cttctgtgat tctcggaaca
   12101  cgtagtgttc gagagctaca tattagttta agcaataagg ttcatctcgg
   12151  cctactgtta caccgaaaag cggatcgtcg gttattgttt accgaaagtg
   12201  agacagttcg ttacgtcgaa acagtggaag tggcggatgt gctgaaggag
   12251  ttcaaaagtt actcggctag ctctctaccg ttggatgaag atgtcgaacc
   12301  actcatggga aagtctgttc aaaaaatttt acggggaggc agattggaag
   12351  aaatacctat ctaaaagtat tgccgcacac tccgcggacg tgaaaaatct
   12401  accagatact caattgtacg gaggtagaat tgtaaagaag tccgattttg
   12451  agtctgcagc tccgagatca ttcgagcagg aattgggact attcatacta
   12501  agcgagcgag atgtggggtg gggcaagatg tgtggcatga ctgtggaaga
   12551  ggcagcgtac caactcacga accccaatgc ttttcctatc gtagctgaga
   12601  aatgtgatcc ggatgtaaag actgaaggcc aaaaatactc gatggaagat
   12651  gttgagaatt tcatgcgtct ttctaactta gatacgagtg atagaacttt
   12701  ggtagagcaa tgttggtctt tatctaattc gtgtggggtt ctgattaatc
   12751  ccgacgataa ggaacgtttc gtgtctctta cgttcaaaaa taacgagtta
   12801  atcaacgact cgagtaacgc aaatatagac tgtcgcgtaa gcgattatct
   12851  agtttacgcc atgtccctat ttaaccaaag agcacagaag tcacaggcgg
   12901  gtaatatttc gctttatgag aagtattgtg ctcatatcag gaagtacttg
   12951  gaaagtaccg atttattctt cacgtcgcct gacaggatac ccttacttac
   13001  tggcattctt tacgactttt gtaaggagta cagtgtcttc tactccacat
   13051  acaagcggaa tgttgacaat ttcaggttct ttttagcaaa ctacatgcct
   13101  ctgatctcgg acatattcgt ttttcagtgg ttgaaaccag cgccggatgt
   13151  tcgattactc ttcgacataa gcgcggccga gctaacttta gaagttccaa
   13201  ctctgagtct ggtagactct caagtggtga taggtcacat cctgagattc
   13251  gtggaatcgt acacggctga cccagctatt gatgcgttag aagaaaaatt
   13301  ggatgctata atgaagttag acaatcctca tctctcgacg gcgcagttgt
   13351  gggtaggttt tttctgttac tacggtgaat ttcgcactgc acaacatcgt
   13401  gtggttccga ggccggacgt atataaaaca cccgagtcgg ttggtggttt
   13451  tgaaataaac atgaagaatg ttgaaagatt ttttgataag cttcaacgag
   13501  agttaccgag cgtttcttta cggcggcaat tcaacggcgc tagagcttat
   13551  gaggctttca aagtatttaa aggcgggaat atcagcttta aacccatctc
   13601  tcgattaaac ataccaaggg aattctggta tctcaacgta gactatttca
   13651  ggcacgcgaa taggagtggt ttgagtgatg aggagatcct cattttgaat
   13701  aatataagca ttgatgttcg gaagttgtgt gctgaaagag cttgcagcac
   13751  cctgcctagc gcgaagcgct ttagcaaagg tcataaaagt agtgtaccat
   13801  caccgcgtca agagcgcaaa gttagagatc cattgattac gttgagaaac
   13851  tccctatatg agttccaaca taggaatagc gataggaggt tccgactctc
   13901  ttgagacctc gggattctta ctatccacgc gaaaggaagc tgtggacaag
   13951  tttttcaatg agctaaggaa tgagaattat tcttcagtcg atagtagtcg
   14001  actgagcgac caagaagtga aggaagttct ggagaaaagt aaagaaagtt
   14051  tcaaaagtga actggcgtct actgatgatc actttgttta tcacatcatc
   14101  ttcttcttga tccggtgcgc tattatatcc acgagtgata aggtgaagta
   14151  tgtggggagt cacaaatacg tcgtcgaagg gaagacatac accgttaacg
   14201  ataattgggt gttcaatatg atgaaaggtc taaccaagca gtataaaagg
   14251  gtgaatggtt tgcgagcctt ttgttgcgct tgtgaagact tgtatctatc
   14301  cgtggctccc atgatgtcag agcgtttcaa aaccaaagct attggtatga
   14351  agggtttacc agctggaaag gagtacttgg gagcggactt cctctcagca
   14401  acgagcaagt taatgggcga tcacgacaga gccgtgtcaa ttgtcgcggc
   14451  taagaatgct gtggatcgca gcgctttcac tggaggggag agaaaaatag
   14501  ttagtttgta tgccttagga aggaactaag cacgttgtgc tatagtacgt
   14551  gccataatag tgagtgctag caaagtataa acgctggtgt ttagcgcata
   14601  ttaaatacta acgatggagc taatgtctga tgagaattta agtactcttg
   14651  tcataaccga tgcctctagc ttaaatggcg tcgataagaa gtcactgtcc
   14701  gcagaactta taaaaatgct cgtgcagagg ggagctcccg ctgaaggtat
   14751  agaggtgatc ttcgggatga tgctatatgc catcgcagcg agaactacat
   14801  cgcctaaagt tcaaaggggc gattctgatg tgttattctc gtacggttct
   14851  ggggatagaa ctattactgt tactgaaggg gatcttaaga aggtgcttga
   14901  cggatttgca cctcttacta ggttcactaa caaacttcga actatgggtc
   14951  gcactttcac agaagcgtat attgatttct gcgtggcgta caagcacaag
   15001  atgcctcagc tcaacgcagc cgcagagttg gggataccgg ctgaagattc
   15051  ttaccttgca gcggattttc tgggagcatg tccgaaactc tctgaactgc
   15101  agcaaagcag aaaaatgttc gcgagtatgt acgctctgaa gactgaaggt
   15151  ggggtagtaa gtacacccgt tagcaatcta cgccaattgg gtaggaggga
   15201  agttatgtga tggaaatctg tactcagaat tccgaatcgc tagtactgct
   15251  ccgcacaact caaaacacaa tactgctagt catcaaatct gatggcaagg
   15301  ttaatttacc taagatacta atatgcggat atttgcgcgt atcctgccac
   15351  ggagacgtga cgggatgctg tcgcgaagac atagtaaaag atttcgaggg
   15401  tgctcatcac actgtaattc gttcgacaac gatacagtac gattacgaat
   15451  ccacagctaa ggagtataat gactcccatt gtgtggtaaa attctttcta
   15501  gagacgggtg acgtcttttg gttttttctc cgaagcgaca gtagaggaag
   15551  agcggcgcgt catttgcgca ccttcttcga agctaacaat ttcttctttg
   15601  gatcgcattg cggtaccatg gagcattgtt tgaagcaggt actgatagaa
   15651  actgagtctg taatcgattc tttttgtgaa gaaagaaatc gttaagatga
   15701  aggtgatagt atctccttat gaagctgaag acattctggc gaggtcaacc
   15751  gatatgttgc gaaacataga cagtggtgtg ttggatatga aggaatgtat
   15801  taaagtattt tcgacgataa cacgagaagt gcattgcgca aaaacctcgt
   15851  atcaatggtg cgttgatact gggttatatc aacgcgactg cgctgaaaaa
   15901  cgcctgatcg ataccatcga gtcgaattta agaatcgctc aacctctcgt
   15951  gcgcgagaag gtggcgaatc atctttgtaa agatgaacct agagagttag
   16001  tggcgttcat tacgcgaaaa tatgttaaac ttacgggtgt gcccattcgg
   16051  gaggccgtaa agatagagat gcgttctcta tctaagacag tattaaataa
   16101  actgtcgtta gaaatggcct tttatatgtc accccgagcg tggaaacacg
   16151  ctgaatggct agatctcaag tatacgcctc taaaaatata tagagatctt
   16201  ttacttgatg tgaacacact caacgcccta tgcgaggagg atgatgttca
   16251  cgtcgtcata aataaagatg aagatggaga tcatgatctc gaccttcaag
   16301  aggactgtta aagtcttttg aatctagaat cgcgatatat acgcgaatag
   16351  taaataaaaa tcgaacgtgg gtgaatctac ctgacgtatc aacttaagct
   16401  gttactaggt aattaagcta acaagtgtta gcgtaatgtg tatgttgatg
   16451  ttgagaaatg gtaccgtatc tagatcggta tttttctctt ctttattttt
   16501  aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa