Sequence of DPV Turnip crinkle virus

Turnip crinkle virus isolate RS2_4_1 coat protein (CP) gene, partial cds.

ACC No: DQ286874

Dated: 2005-12-08 | Length: 1050 | CRC: -2124041527

                
ID   DQ286874   standard; genomic RNA; VRL; 1050 BP.
XX
AC   DQ286874;
XX
SV   DQ286874.1
XX
DT   05-DEC-2005 (Rel. 86, Created)
DT   08-DEC-2005 (Rel. 86, Last updated, Version 4)
XX
DE   Turnip crinkle virus isolate RS2_4_1 coat protein (CP) gene, partial cds.
XX
KW   .
XX
OS   Turnip crinkle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1050
RA   Li Y.H., Pallett D.W., Naylor M., Wang H.;
RT   "Low titer chronic infections maintain polymorphisms in the coat protein of
RT   Turnip crinkle virus";
RL   Unpublished.
XX
RN   [2]
RP   1-1050
RA   Li Y.H., Pallett D.W., Naylor M., Wang H.;
RT   ;
RL   Submitted (10-NOV-2005) to the EMBL/GenBank/DDBJ databases.
RL   Plant Virology, NERC/Centre for Ecology and Hydrology (CEH), Mansfield
RL   Road, Oxford OX1 3SR, United Kingdom
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1050
FT                   /country="United Kingdom"
FT                   /db_xref="taxon:11988"
FT                   /mol_type="genomic RNA"
FT                   /organism="Turnip crinkle virus"
FT                   /isolate="RS2_4_1"
FT   gene            1. .>1050
FT                   /gene="CP"
FT   CDS             1. .>1050
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="ABB89501.1"
FT                   /translation="MENDPRVRKFASEGAQWAIKWQKKGWSSLTSRQKQTARAAMGIKL
FT                   SPVAQPVQKVTRLSAPVALAYREVSTQPRVSTARDGITRSGSELITTLKKNTDTEPKYT
FT                   TAVLNPSEPGTFNQLIKEAAQYEKYRFTSLRFRYSPMSPSTTGGKVALAFDRDAAKPPP
FT                   NDLASLYNIEGCVSSVPWTGFILTVPPDSTDRFVADGISDPKLVDFGKLIMATYGQGAN
FT                   DAAQLGEVRVEYTVQLKNRTGSTSDAQIGDFAGVKDGPRLVSWSKTKGTAGWEHDCHFL
FT                   GTGNFSLTLFYEKAPVSGLENADASDFSVLGEAAAGSVQWAGVKVAERGQSVKMVTTEE
FT                   QPRGKWQALR"
XX
SQ   Sequence 1050 BP; 272 A; 293 C; 292 G; 193 T; 0 other;

dq286874 Length: 1050  08-DEC-2005  Type: N  Check: 2168  ..

       1  atggaaaatg atcctagagt ccgaaagttc gcatccgagg gcgcccaatg
      51  ggcgataaag tggcagaaga agggctggtc atccctaacc agcagacaga
     101  aacagaccgc ccgcgcagcg atggggatca agctctcccc tgtggcgcaa
     151  cctgtgcaga aagtgactcg actgagtgct ccggtggctc tcgcctaccg
     201  cgaggtttcc acccagcctc gggtttctac tgccagggac ggcataacca
     251  gaagcggttc tgaactgatc acaaccctga agaagaacac tgacactgaa
     301  cctaagtaca ccacagctgt gcttaaccca agcgaacccg gaacattcaa
     351  ccaactcatc aaggaggcgg cccagtatga aaaataccga ttcacgtcac
     401  tcagatttag gtactctccc atgagccctt caaccaccgg gggcaaggtg
     451  gctctggcat tcgaccgaga cgccgccaaa cccccgccca acgacctcgc
     501  ttccctctac aacatagagg gttgtgtatc tagcgtgccc tggacagggt
     551  ttattttgac cgtcccacca gattctactg accgctttgt ggcggatggt
     601  atcagcgatc caaagcttgt cgatttcggc aaactcatca tggccaccta
     651  tggccaagga gccaatgatg ccgcccaact cggtgaagtg cgagtcgagt
     701  acaccgtgca gctcaagaac agaactggct caaccagcga cgcccagatt
     751  ggggacttcg cgggtgttaa ggacggaccc aggttggtct cgtggtccaa
     801  gaccaaggga acagctgggt gggagcacga ttgtcatttt ctcggaaccg
     851  gaaacttctc gttgacactg ttctacgaga aggcgcccgt ttcggggcta
     901  gaaaacgcag acgcctctga cttctcggtc ctgggagaag ccgcagcagg
     951  tagtgtccaa tgggctggag tgaaggtagc agaaagggga caaagcgtga
    1001  aaatggtcac aactgaggag cagccaaggg gaaaatggca agcactcagg