Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate Arv1 major coat protein (ORF6) gene, complete cds.

ACC No: DQ314588

Dated: 2006-06-03 | Length: 713 | CRC: 725706005

                
ID   DQ314588   standard; genomic RNA; VRL; 713 BP.
XX
AC   DQ314588;
XX
SV   DQ314588.1
XX
DT   03-JUN-2006 (Rel. 88, Created)
DT   03-JUN-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate Arv1 major coat protein
DE   (ORF6) gene, complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-713
RA   Angelini E., Bertazzon N., Borgo M.;
RT   "Genomic variability of grapevine leafroll-associated virus 2";
RL   Unpublished.
XX
RN   [2]
RP   1-713
RA   Angelini E., Bertazzon N., Borgo M.;
RT   ;
RL   Submitted (02-DEC-2005) to the EMBL/GenBank/DDBJ databases.
RL   Sezione Biologia e Difesa, C.R.A. Istituto Sperimentale per la Viticoltura,
RL   Viale XXVIII Aprile 26, Conegliano, TV I-31015, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .713
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /specific_host="Vitis vinifera biotype Arvino"
FT                   /isolate="Arv1"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy"
FT                   /db_xref="taxon:64003"
FT   gene            82. .678
FT                   /gene="ORF6"
FT   CDS             82. .678
FT                   /codon_start=1
FT                   /gene="ORF6"
FT                   /product="major coat protein"
FT                   /protein_id="ABC66071.1"
FT                   /translation="MELMSDDNLSNLVITDASSLNGVDKKLLSAEIIKMLVQKGAPNDG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDVIFSNRFGESNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 713 BP; 207 A; 148 C; 178 G; 180 T; 0 other;

dq314588 Length: 713  03-JUN-2006  Type: N  Check: 5560  ..

       1  ggaggtacta agcacgttgt gctatagtgc gtgctataaa taataaaaca
      51  ctagtgctta agtcgcgcag agaaaaacac tatggagttg atgtccgacg
     101  acaaccttag caacctggtg ataactgacg cctctagtct aaatggtgtc
     151  gataagaaac ttttatctgc agaaatcata aaaatgttgg tgcagaaagg
     201  cgctcctaac gacggtatag aagtggtgtt cggtctactc ctttacgcgc
     251  ttgcagcgag aaccacatct cctaaagttc agcgcgccga ttcagacgtg
     301  attttttcta accgttttgg agagagtaac gtggtagtga cggagggtga
     351  ccttaagaag gtgctcgacg ggtgcgcacc tctcactagg ttcactaata
     401  aacttagaac cttcggtcgc actttcactg aggcttacgt tgatttttgt
     451  atcgcgtata agcacaaatt accgcaactc aacgccgcag cggaattggg
     501  aattccggct gaagattcat acttggctgc agattttctg ggtacttgcc
     551  cgaagctctc tgaactgcag caaagcagaa agatgttcgc gagcatgtac
     601  gctctaaaaa ctgaaggtgg agtggtaaat acaccagtga gcaatctgcg
     651  tcagctaggt agaagagaag ttatgtaatg gagaattacg aagaaaaatc
     701  tgaatcgctc gtc