Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate IsP major coat protein (ORF6) gene, complete cds.

ACC No: DQ314591

Dated: 2006-06-03 | Length: 714 | CRC: 1311725551

                
ID   DQ314591   standard; genomic RNA; VRL; 714 BP.
XX
AC   DQ314591;
XX
SV   DQ314591.1
XX
DT   03-JUN-2006 (Rel. 88, Created)
DT   03-JUN-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate IsP major coat protein (ORF6)
DE   gene, complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-714
RA   Angelini E., Bertazzon N., Borgo M.;
RT   "Genomic variability of grapevine leafroll-associated virus 2";
RL   Unpublished.
XX
RN   [2]
RP   1-714
RA   Angelini E., Bertazzon N., Borgo M.;
RT   ;
RL   Submitted (02-DEC-2005) to the EMBL/GenBank/DDBJ databases.
RL   Sezione Biologia e Difesa, C.R.A. Istituto Sperimentale per la Viticoltura,
RL   Viale XXVIII Aprile 26, Conegliano, TV I-31015, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .714
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /specific_host="Vitis vinifera cv. Isabella nera 'precoce'"
FT                   /isolate="IsP"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /db_xref="taxon:64003"
FT   gene            80. .676
FT                   /gene="ORF6"
FT   CDS             80. .676
FT                   /codon_start=1
FT                   /gene="ORF6"
FT                   /product="major coat protein"
FT                   /protein_id="ABC66074.1"
FT                   /translation="MELMSDSNLSNLVITDASSLNGVDKKLLSAEVVKMLVQKGAPNEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDVIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 714 BP; 198 A; 146 C; 190 G; 180 T; 0 other;

dq314591 Length: 714  03-JUN-2006  Type: N  Check: 9778  ..

       1  ggaggtacta agcacgttgt gctatagtgc gtgctataat aataaacact
      51  agtgcttaag tcgcgcagag gaaaacgcta tggagttgat gtccgacagc
     101  aaccttagca acctggtgat aaccgacgcc tctagtctaa atggtgtcga
     151  caagaaactt ttatctgctg aagttgtgaa aatgttggtg cagaaagggg
     201  ctcctaacga gggtatagaa gtggtgttcg gtctactcct ttacgcactc
     251  gcggcaagaa ccacgtctcc taaggttcag cgcgctgatt cagacgttat
     301  attttcaaat agtttcggag agaggaatgt ggtagtgaca gagggtgacc
     351  ttaagaaggt gctcgacggg tgtgcgcctc tcactaggtt cactaataaa
     401  cttagaacgt tcggtcgcac tttcactgag gcttacgttg acttttgtat
     451  cgcgtataag cacaagttac cccaactcaa cgccgcggcg gaattgggga
     501  tcccagctga agattcgtac ttagctgcag attttctggg tacttgcccg
     551  aagctctctg aattgcagca aagtaggaag atgttcgcga gtatgtacgc
     601  tctaaaaact gaaggtggag tggtaaacac accagtgagc aatctgcgtc
     651  agctgggtag aagggaagtt atgtaatgga agatcacaaa gaaaaatccg
     701  aatcgctatc tgtc