Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate Red2 major coat protein (ORF6) gene, complete cds.

ACC No: DQ314603

Dated: 2006-06-03 | Length: 710 | CRC: -606552118

                
ID   DQ314603   standard; genomic RNA; VRL; 710 BP.
XX
AC   DQ314603;
XX
SV   DQ314603.1
XX
DT   03-JUN-2006 (Rel. 88, Created)
DT   03-JUN-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate Red2 major coat protein
DE   (ORF6) gene, complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-710
RA   Angelini E., Bertazzon N., Borgo M.;
RT   "Genomic variability of grapevine leafroll-associated virus 2";
RL   Unpublished.
XX
RN   [2]
RP   1-710
RA   Angelini E., Bertazzon N., Borgo M.;
RT   ;
RL   Submitted (02-DEC-2005) to the EMBL/GenBank/DDBJ databases.
RL   Sezione Biologia e Difesa, C.R.A. Istituto Sperimentale per la Viticoltura,
RL   Viale XXVIII Aprile 26, Conegliano, TV I-31015, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .710
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /specific_host="Vitis vinifera cv. Red globe"
FT                   /isolate="Red2"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy"
FT                   /db_xref="taxon:64003"
FT   gene            85. .681
FT                   /gene="ORF6"
FT   CDS             85. .681
FT                   /codon_start=1
FT                   /gene="ORF6"
FT                   /product="major coat protein"
FT                   /protein_id="ABC66086.1"
FT                   /translation="MELMSDSNLSNLVITDASSLNGVDKKLLSAEVVKMLVQKGAPNEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDVIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 710 BP; 200 A; 144 C; 189 G; 177 T; 0 other;

dq314603 Length: 710  03-JUN-2006  Type: N  Check: 4988  ..

       1  ctagggaggt actaagcacg ttgtgctata gtgcgtgcta taataataaa
      51  cactagtgct taagacgcgc agaggaaaac gctcatggag ttgatgtccg
     101  acagcaacct tagcaacctg gtgataaccg acgcctctag tctaaatggt
     151  gtcgacaaga aacttttatc tgctgaagtt gtgaaaatgt tggtgcagaa
     201  aggggctcct aacgagggta tagaagtggt gttcggtcta ctcctttacg
     251  cactcgcggc aagaaccacg tctcctaagg ttcagcgcgc tgattcagac
     301  gttatatttt caaatagttt cggagagagg aatgtggtag tgacagaggg
     351  tgaccttaag aaggtgctcg acgggtgtgc gcctctcact aggttcacta
     401  ataaacttag aacgttcggt cgcactttca ctgaggctta cgttgacttt
     451  tgtatcgcgt ataagcacaa gttaccccaa ctcaacgccg cggcggaatt
     501  ggggatccca gctgaagatt cgtacttagc tgcagatttt ctgggtactt
     551  gcccgaagct ctctgaattg cagcaaagta ggaagatgtt cgcgagtatg
     601  tacgctctaa aaactgaagg tggagtggta aatacaccag tgagcaatct
     651  gcgtcagctg ggtagaaggg aagttatgta atggaagatc acaaagaaaa
     701  atccgaatca