Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate Rei major coat protein (ORF6) gene, complete cds.

ACC No: DQ314604

Dated: 2006-06-03 | Length: 687 | CRC: -1218883438

                
ID   DQ314604   standard; genomic RNA; VRL; 687 BP.
XX
AC   DQ314604;
XX
SV   DQ314604.1
XX
DT   03-JUN-2006 (Rel. 88, Created)
DT   03-JUN-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate Rei major coat protein (ORF6)
DE   gene, complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-687
RA   Angelini E., Bertazzon N., Borgo M.;
RT   "Genomic variability of grapevine leafroll-associated virus 2";
RL   Unpublished.
XX
RN   [2]
RP   1-687
RA   Angelini E., Bertazzon N., Borgo M.;
RT   ;
RL   Submitted (02-DEC-2005) to the EMBL/GenBank/DDBJ databases.
RL   Sezione Biologia e Difesa, C.R.A. Istituto Sperimentale per la Viticoltura,
RL   Viale XXVIII Aprile 26, Conegliano, TV I-31015, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .687
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /specific_host="Vitis vinifera cv. Regina"
FT                   /isolate="Rei"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy"
FT                   /db_xref="taxon:64003"
FT   gene            76. .672
FT                   /gene="ORF6"
FT   CDS             76. .672
FT                   /codon_start=1
FT                   /gene="ORF6"
FT                   /product="major coat protein"
FT                   /protein_id="ABC66087.1"
FT                   /translation="MELMSDSNLSNLVITDASSLNGVDKKLLSAEVVKMLVQKGAPNEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDVIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 687 BP; 195 A; 136 C; 180 G; 176 T; 0 other;

dq314604 Length: 687  03-JUN-2006  Type: N  Check: 9929  ..

       1  gtactaagca cggtgtgcta tagtgcgtgc tataataata aacactagtg
      51  cttaagtcgc gcagaagaaa acgctatgga gttgatgtcc gacagcaacc
     101  ttagcaacct ggtgataacc gacgcctcta gtctaaatgg tgtcgacaag
     151  aagcttttat ctgctgaagt tgtaaaaatg ttggtgcaga aaggggctcc
     201  taacgagggt atagaagtgg tgttcggtct actcctttac gcactcgcgg
     251  caagaaccac gtctcctaag gttcagcgcg cagattcaga cgttatattt
     301  tcaaatagtt tcggagagag gaatgtggta gtaacagagg gtgaccttaa
     351  gaaggtactc gacgggtgtg cgcctctcac taggttcact aataaactta
     401  gaacgttcgg tcgtactttc actgaggctt acgttgactt ttgtatcgcg
     451  tataagcaca aattacccca actcaacgcc gcggcggaat tggggattcc
     501  agctgaagat tcgtacttag ctgcagattt tctgggtact tgcccgaagc
     551  tctctgaatt acagcaaagt aggaagatgt tcgcgagtat gtacgctcta
     601  aaaactgaag gtggagtggt aaatacacca gtgagcaatc tgcgtcagct
     651  aggtagaagg gaagttatgt aatggaagat tacgaag