Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate FS627 clone CL143 coat protein (p25) gene, complete cds.

ACC No: DQ355039

Dated: 2010-10-31 | Length: 672 | CRC: 2126753814

                
ID   DQ355039; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   DQ355039;
XX
DT   14-MAR-2006 (Rel. 87, Created)
DT   31-OCT-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate FS627 clone CL143 coat protein (p25) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   DOI; 10.1094/PHYTO-99-11-1297.
RX   PUBMED; 19821734.
RA   Roy A., Brlansky R.H.;
RT   "Population dynamics of a Florida Citrus tristeza virus isolate and
RT   aphid-transmitted subisolates: identification of three genotypic groups and
RT   recombinants after aphid transmission";
RL   Phytopathology 99(11):1297-1306(2009).
XX
RN   [2]
RP   1-672
RA   Roy A., Brlansky R.H.;
RT   ;
RL   Submitted (04-JAN-2006) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, University of Florida, 700, Experimet Station Road, Crec,
RL   Lake Alfred, FL 33850, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="FS627"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /clone="CL143"
FT                   /note="genotype: T30; PCR_primers=fwd_name: T36CP (+),
FT                   rev_name: T36CP (-)"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /note="ORF7"
FT                   /db_xref="GOA:Q9IFW4"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q9IFW4"
FT                   /protein_id="ABD67143.1"
FT                   /translation="MDDETKKLKNKNKETKEGDEVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 199 A; 122 C; 170 G; 181 T; 0 other;

dq355039 Length: 672  31-OCT-2010  Type: N  Check: 2796  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgaa gttgttgctg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagtact
     151  caacagaatg ctgctttgaa cagggactta tttcttgctc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgatt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacatcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt atttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga