Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate FS627 clone CL120 coat protein (p25) gene, complete cds.

ACC No: DQ355047

Dated: 2010-10-31 | Length: 672 | CRC: -730461713

                
ID   DQ355047; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   DQ355047;
XX
DT   14-MAR-2006 (Rel. 87, Created)
DT   31-OCT-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate FS627 clone CL120 coat protein (p25) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   DOI; 10.1094/PHYTO-99-11-1297.
RX   PUBMED; 19821734.
RA   Roy A., Brlansky R.H.;
RT   "Population dynamics of a Florida Citrus tristeza virus isolate and
RT   aphid-transmitted subisolates: identification of three genotypic groups and
RT   recombinants after aphid transmission";
RL   Phytopathology 99(11):1297-1306(2009).
XX
RN   [2]
RP   1-672
RA   Roy A., Brlansky R.H.;
RT   ;
RL   Submitted (04-JAN-2006) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, University of Florida, 700, Experimet Station Road, Crec,
RL   Lake Alfred, FL 33850, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="FS627"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /clone="CL120"
FT                   /note="genotype: T36; PCR_primers=fwd_name: T36CP (+),
FT                   rev_name: T36CP (-)"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /note="ORF7"
FT                   /db_xref="GOA:Q2ESY8"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ESY8"
FT                   /protein_id="ABD67149.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFSSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKHPNLPDKDKDFHIVMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADDIVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 197 A; 125 C; 167 G; 183 T; 0 other;

dq355047 Length: 672  31-OCT-2010  Type: N  Check: 1934  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacaaaaga
      51  aggcgacgat gttgttgctg ccgagtcttc tttcagttcc gtaaacttac
     101  acatcgatcc gactttgata acgatgaacg atgtgcgtca gttgagtacc
     151  caacagaacg ctgctttgaa cagagactta ttccttactt tgaaagggaa
     201  gcatcctaac ttacctgata aagataagga ctttcacata gttatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgacgcc
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaactctaa gggtattggt aatcgtacca
     401  acgcccttcg agtttggggt agaaccaacg atgcccttta cttagctttt
     451  tgcagacaga atcgcaattt gagttatggc gggcgtccgc tagacgcagg
     501  gattccggcc gggtatcatt acttgtgtgc ggatttcttg actggagctg
     551  gtttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaatta
     601  ttgaagaagc gaggggctga tgatatcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga