Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone AR128 coat protein gene, complete cds.

ACC No: DQ363385

Dated: 2012-07-27 | Length: 672 | CRC: 1035459995

                
ID   DQ363385; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   DQ363385;
XX
DT   16-FEB-2006 (Rel. 86, Created)
DT   27-JUL-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Citrus tristeza virus clone AR128 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Brlansky R.H., Roy A., Damsteegt V.D.;
RT   "Stem-Pitting Citrus tristeza virus Predominantly Transmitted by the Brown
RT   Citrus Aphid from Mixed Infections Containing Non-Stem-Pitting and
RT   Stem-Pitting Isolates";
RL   Plant Dis. 95(8):913-920(2011).
XX
RN   [2]
RP   1-672
RA   Roy A., Brlansky R.H., Damsteegt V.;
RT   "Aphid Transmission of Stem Pitting Citrus tristeza virus from Mixed Virus
RT   Infections";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Roy A., Brlansky R.H., Damsteegt V.;
RT   ;
RL   Submitted (13-JAN-2006) to the INSDC.
RL   Plant Pathology, University of Florida, 700 Experiment Station Road, Crec,
RL   Lake Alfred, FL 33850, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="B408"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /clone="AR128"
FT                   /note="genotype: SY568"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q2ESZ4"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ESZ4"
FT                   /protein_id="ABD18612.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSLGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 125 C; 175 G; 181 T; 0 other;

dq363385 Length: 672  27-JUL-2012  Type: N  Check: 3288  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgctg cggagtcttc tctcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaggtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga cgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga