Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone AR145 coat protein gene, complete cds.

ACC No: DQ363391

Dated: 2012-07-27 | Length: 672 | CRC: -730461713

                
ID   DQ363391; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   DQ363391;
XX
DT   16-FEB-2006 (Rel. 86, Created)
DT   27-JUL-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Citrus tristeza virus clone AR145 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Brlansky R.H., Roy A., Damsteegt V.D.;
RT   "Stem-Pitting Citrus tristeza virus Predominantly Transmitted by the Brown
RT   Citrus Aphid from Mixed Infections Containing Non-Stem-Pitting and
RT   Stem-Pitting Isolates";
RL   Plant Dis. 95(8):913-920(2011).
XX
RN   [2]
RP   1-672
RA   Roy A., Brlansky R.H., Damsteegt V.;
RT   "Aphid Transmission of Stem Pitting Citrus tristeza virus from Mixed Virus
RT   Infections";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Roy A., Brlansky R.H., Damsteegt V.;
RT   ;
RL   Submitted (13-JAN-2006) to the INSDC.
RL   Plant Pathology, University of Florida, 700 Experiment Station Road, Crec,
RL   Lake Alfred, FL 33850, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="FS627"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /clone="AR145"
FT                   /note="genotype: T36"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q2ESY8"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ESY8"
FT                   /protein_id="ABD18618.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFSSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKHPNLPDKDKDFHIVMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADDIVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 197 A; 125 C; 167 G; 183 T; 0 other;

dq363391 Length: 672  27-JUL-2012  Type: N  Check: 1934  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacaaaaga
      51  aggcgacgat gttgttgctg ccgagtcttc tttcagttcc gtaaacttac
     101  acatcgatcc gactttgata acgatgaacg atgtgcgtca gttgagtacc
     151  caacagaacg ctgctttgaa cagagactta ttccttactt tgaaagggaa
     201  gcatcctaac ttacctgata aagataagga ctttcacata gttatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgacgcc
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaactctaa gggtattggt aatcgtacca
     401  acgcccttcg agtttggggt agaaccaacg atgcccttta cttagctttt
     451  tgcagacaga atcgcaattt gagttatggc gggcgtccgc tagacgcagg
     501  gattccggcc gggtatcatt acttgtgtgc ggatttcttg actggagctg
     551  gtttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaatta
     601  ttgaagaagc gaggggctga tgatatcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga