Sequence of DPV Hibiscus chlorotic ringspot virus

Hibiscus chlorotic ringspot virus isolate TW, complete genome.

ACC No: DQ392986

Dated: 2006-03-02 | Length: 3910 | CRC: 546101893

                
ID   DQ392986   standard; genomic RNA; VRL; 3910 BP.
XX
AC   DQ392986;
XX
SV   DQ392986.1
XX
DT   02-MAR-2006 (Rel. 87, Created)
DT   02-MAR-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Hibiscus chlorotic ringspot virus isolate TW, complete genome.
XX
KW   .
XX
OS   Hibiscus chlorotic ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-3910
RA   Li S.-C., Chang Y.-C.;
RT   "Study and cloning of a Taiwan isolate of Hibiscus chlorotic ringspot
RT   virus";
RL   Unpublished.
XX
RN   [2]
RP   1-3910
RA   Li S.-C., Chang Y.-C.;
RT   ;
RL   Submitted (07-FEB-2006) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Pathology and Microbiology, National Taiwan University,
RL   1, Section 4, Roosevelt Road, Taipei, Taiwan 10617, R.O.C.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3910
FT                   /organism="Hibiscus chlorotic ringspot virus"
FT                   /specific_host="Hibiscus rosa-sinensis"
FT                   /isolate="TW"
FT                   /mol_type="genomic RNA"
FT                   /country="Taiwan"
FT                   /virion
FT                   /db_xref="taxon:53181"
FT   CDS             31. .2238
FT                   /codon_start=1
FT                   /transl_except=(pos:673. .675,aa:OTHER)
FT                   /product="p81 protein"
FT                   /note="putative RdRp"
FT                   /protein_id="ABD48708.1"
FT                   /translation="MFSHVFSLAYETVSLSAALCVATLAAAYEIVTHPRIAPRDPCIAE
FT                   ELCMRDELEVNEPSDEDAEACLEALPSSAGDKKVLKVKRKHRGKFALHAAIAAKLHFGG
FT                   TPTPTRSNELAVRRWLASYCKERRLVDTHAVQAIALATPLVLTPGAAEITERAILNSPV
FT                   FGMRRAALAEASKPSSLKYQMVFEAHRARTWLRAWRKLVGLPDFQGYTTMKXGCLREIA
FT                   GVDTQIVRGEHQAMAVFPREGFSKPRRIFHVCGMGNGTTFGVHNNSLANLRRGLVERVF
FT                   YVEDASKNLVPTPRPLPGKFQELKYLARRVARIAGHHTPIPRESYPGLYKGRRFQIYAG
FT                   AVESLASNPIHRRDSFLKTFVKAEKINFSAKPDPAPRVIQPRDPRYNVEVGRYLKPYEH
FT                   HLYRALDVVWKGPTVLKGYTVSEIGNIMHLHWSQFQKPCAVGFDMKRFDQHVSVDALRF
FT                   EHSVYGRSFCSKELDRLLEWQLLNSGVGHANDGYIRYKVDGCRMSGDVNTAMGNCLLAC
FT                   LITKHLLKGIRCRLINNGDDCVLFFDAPDLAAVTERLAHWLDFGFQCVVEAPVYELEQV
FT                   EFCQMKPVFDGQEWICVRNVHVSVAKDTYSINPWNNVADAGRWIRAIGECGESLTGGIP
FT                   VLNAYYGVFKRAYGAAGKVKESLAFDSGMYRLSQRCSRVFHEPTEEARVSFYKAFGVDP
FT                   LAQVAIESFYDEMEIELEFTPEGKPDDISLQWLLRNRTPNS"
FT   CDS             31. .675
FT                   /codon_start=1
FT                   /product="p28 protein"
FT                   /note="putative RdRp subunit"
FT                   /protein_id="ABD48707.1"
FT                   /translation="MFSHVFSLAYETVSLSAALCVATLAAAYEIVTHPRIAPRDPCIAE
FT                   ELCMRDELEVNEPSDEDAEACLEALPSSAGDKKVLKVKRKHRGKFALHAAIAAKLHFGG
FT                   TPTPTRSNELAVRRWLASYCKERRLVDTHAVQAIALATPLVLTPGAAEITERAILNSPV
FT                   FGMRRAALAEASKPSSLKYQMVFEAHRARTWLRAWRKLVGLPDFQGYTTMK"
FT   CDS             41. .670
FT                   /codon_start=1
FT                   /product="p23 protein"
FT                   /note="putative protein"
FT                   /protein_id="ABD48709.1"
FT                   /translation="MSFHSLMKLFLSVRHCVSQPLQLLMKLLRTPVSLPATPALLKSCA
FT                   CVMSSRLMSPLMRTLRLVWKLFPLLQAIRKCSKLRGSTGVSLRSMLPSQLSSTLGVLQP
FT                   QRALTSLQCGGGLRAIARKGGWLTHTLYKRSLWPLLWYLRQGPLKSLSERSLIVLCLEC
FT                   GGRLWPKLRSRAASNIKWCLRLIGRERGSGPGGSWWVSLIFRGTPP"
FT   CDS             2205. .2417
FT                   /codon_start=1
FT                   /product="p8 protein"
FT                   /note="putative movement protein"
FT                   /protein_id="ABD48710.1"
FT                   /translation="MASTQPNTEFIEINPHDTSLQKGAGKGNRQAKKEVALQAVHKANK
FT                   QDEAISGGSFVFVADKVEVTININF"
FT   CDS             2344. .2580
FT                   /codon_start=1
FT                   /product="p9 protein"
FT                   /note="putative movement protein"
FT                   /protein_id="ABD48711.1"
FT                   /translation="MRLFLGVLSFLLLIKLRLLSTSTFEVDWRTLRENLLIISTLSLFG
FT                   FFVTVLIKAESEHIHFHSHDSSKTQNIVVNTGK"
FT   CDS             2590. .3627
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /note="p38 protein"
FT                   /protein_id="ABD48712.1"
FT                   /translation="MLQKNDPAVQRAYNAHLPWAIKLKNDGWAALSKGQKRAANRYAGG
FT                   TRPVTSQVKLSTLKVTAPVAASLRTRNPGANIRTAGKSVTVVHCEFVGNVARQTGSGLL
FT                   VVERTINPSNVLSFPWLSVLAAGYEKYRVSSLSLRYSPTCATTTEGKVILAFDKDAADA
FT                   SPTSKSDMYNHDGAVGVSPWDSAMLQVPCDTVDRFINDSSSSDPKLVDFGKVVVANYGQ
FT                   SEGDVDVIGELFLQYSITLKIPQGTATLTQSGVGITSTGPSLFRVQLSESTYVFTCNGT
FT                   GRFLFFFNSTVDATSTISGMEVKQKSSTDDKGETTILELLATESGGKIAILADKGTITW
FT                   WACRN"
FT   CDS             2603. .3277
FT                   /codon_start=1
FT                   /product="p25 protein"
FT                   /note="putative protein"
FT                   /protein_id="ABD48713.1"
FT                   /translation="MTQPFSARIMPIYLGQSNSRTMGGLLFLRVRKEQPIDTRVEPVLL
FT                   LLKLSCQHLKLRLQWPPRCGHATLERTLGRLENRSPSSIASLWAMSPGRLVVGYWWLRG
FT                   QSIPATYSASPGFLYSLPDTRSTACHHCLLDILQLVPQPRRARSSWRLIKTLQMLPPPP
FT                   RATCITMMEQLESRPGTVQCCKYLVILWIGLLMIPVVPTLSLLTLVRWLLPIMANLKGM
FT                   WM"
XX
SQ   Sequence 3910 BP; 952 A; 912 C; 1030 G; 1016 T; 0 other;

dq392986 Length: 3910  02-MAR-2006  Type: N  Check: 1275  ..

       1  gggaaaccgt ggcaagtttc cgaatcatct atgttctccc atgtcttttc
      51  actcgcttat gaaactgttt ctctcagtgc ggcactgtgt gtcgcaaccc
     101  ttgcagctgc ttatgaaatt gttacgcacc cccgtatcgc tccccgcgac
     151  ccctgcattg ctgaagagtt gtgcatgcgt gatgagctcg aggttaatga
     201  gccctctgat gaggacgctg aggcttgtct ggaagctctt ccctcttctg
     251  caggcgataa gaaagtgctc aaagttaaga ggaagcacag gggtaagttt
     301  gcgctccatg ctgccatcgc agctaagctc cactttgggg gtactccaac
     351  cccaacgcgc tctaacgagc ttgcagtgcg gaggtggctt gcgagctatt
     401  gcaaggaaag gaggctggtt gacacacacg ctgtacaagc gatcgctctg
     451  gccactcctc tggtacttac gccaggggcc gctgaaatca ctgagcgagc
     501  gatccttaat agtcctgtgt ttggaatgcg gagggcggct ctggccgaag
     551  cttcgaagcc gagcagcctc aaatatcaaa tggtgtttga ggctcatcgg
     601  gcgagaacgt ggctcagggc ctggcggaag ttggtgggtc tccctgattt
     651  tcaggggtac accaccatga aataggggtg ccttagggaa atagctggtg
     701  tggacactca aattgtccgt ggagagcacc aggctatggc cgtattccct
     751  agggaaggat tctccaaacc ccggcgcatc ttccatgtct gtggaatggg
     801  taatgggacc accttcggag ttcacaacaa ttctcttgct aatttacggc
     851  gggggcttgt tgagagggtg ttctacgtcg aagatgccag caaaaatcta
     901  gtcccaaccc ctcggcccct acctggtaaa ttccaggagt tgaagtatct
     951  ggcacgacgc gtcgcgcgca ttgctggaca tcatacccct atccccaggg
    1001  aaagttatcc tgggttgtat aagggcagga ggttccaaat ttatgcgggc
    1051  gcggtcgaga gtttagcttc caatcctatt cataggaggg attcctttct
    1101  caagactttc gtgaaagccg aaaagatcaa cttttcggcg aaaccagacc
    1151  ctgctcctag agttatccag cctagggatc cgagatataa tgtagaggta
    1201  ggtagatatc ttaagcccta cgagcaccat ctatatagag ctctagatgt
    1251  tgtttggaaa gggcccactg tgcttaaggg atatactgtt agcgaaatag
    1301  ggaatattat gcatttacac tggtcacaat tccagaaacc atgtgctgtt
    1351  ggatttgaca tgaagagatt tgatcagcac gtttctgtgg atgcgctgcg
    1401  atttgaacat tctgtgtacg gaaggagttt ttgctcaaaa gagcttgaca
    1451  gattgttgga atggcagctc ctcaactctg gggttggaca tgcaaatgac
    1501  gggtacatta ggtacaaggt tgatggatgt aggatgagtg gagacgtgaa
    1551  cactgcaatg ggcaattgtc tcctcgcctg cttgattacc aaacacctcc
    1601  tgaagggcat cagatgtaga ctcatcaata atggtgatga ctgtgtcctc
    1651  ttcttcgacg ctccagatct agctgcggtc actgaacggt tggctcactg
    1701  gcttgatttt ggattccagt gcgtggttga ggctccagtt tatgagctag
    1751  aacaggttga gttttgtcag atgaaaccag tgtttgatgg gcaggagtgg
    1801  atatgtgtta ggaatgttca cgtctcggta gcgaaggata cttactctat
    1851  caatccttgg aacaatgtgg ctgatgctgg taggtggatc agagccattg
    1901  gggaatgcgg tgagtctctc accgggggca tcccagtgct aaatgcatat
    1951  tatggtgtgt ttaagagagc ttatggtgcc gcggggaaag taaaggagag
    2001  tttggcattt gattctggaa tgtatagact ctcccaaagg tgttctaggg
    2051  tgtttcatga acccactgaa gaagctagag tgagtttcta caaggctttt
    2101  ggggtggatc ccctggctca agttgcaatt gaatcattct atgatgagat
    2151  ggaaattgag ttggaattca ccccggaggg aaagcctgat gatatctcac
    2201  tccaatggct tctacgcaac cgaacaccga attcatagag atcaatcccc
    2251  acgacaccag cttacagaag ggcgcaggca agggaaatag acaggctaag
    2301  aaagaagtag cactccaagc agtgcacaag gccaacaagc aggatgaggc
    2351  tatttctggg ggttctttcg tttttgttgc tgataaagtt gaggttacta
    2401  tcaacatcaa cttttgaggt tgactggaga accctccggg aaaacttact
    2451  catcatttca acgcttagtc tgtttgggtt ttttgtcact gtcctgatca
    2501  aggctgagtc agaacacatc catttccatt cgcacgacag tagtaagaca
    2551  cagaacatag tagtaaatac tggcaagtga cctatcgaca tgctgcagaa
    2601  gaatgaccca gccgttcagc gcgcgtataa tgcccattta ccttgggcaa
    2651  tcaaactcaa gaacgatggg tgggctgctc tttctaaggg tcagaaaaga
    2701  gcagccaatc gatacgcggg tggaacccgt cctgttactt ctcaagttaa
    2751  gctgtcaaca cttaaagtta cggctccagt ggccgcctcg ttgcggacac
    2801  gcaaccctgg agcgaacatt aggacggctg gaaaatcggt caccgtcgtc
    2851  cattgcgagt ttgtgggcaa tgtcgcccgg cagactggta gtgggctact
    2901  ggtggttgag aggacaatca atcccagcaa cgtactcagc ttcccctggc
    2951  tttctgtact cgctgccgga tacgagaagt accgcgtgtc atcactgtct
    3001  cttagatatt ctccaacttg tgccacaacc acggagggca aggtcatctt
    3051  ggcgtttgat aaagacgctg cagatgcttc ccccacctcc aagagcgaca
    3101  tgtataacca tgatggagca gttggagtct cgccctggga cagtgcaatg
    3151  ctgcaagtac cttgtgatac tgtggatagg tttattaatg attccagtag
    3201  ttccgaccct aagcttgttg actttggtaa ggtggttgtt gccaattatg
    3251  gccaatctga aggggatgtg gatgtgattg gggagctatt cctgcaatac
    3301  tcgatcaccc tcaagatccc ccagggtaca gcgacactca cacagtccgg
    3351  cgtgggaatc acatcaactg ggccctccct cttccgggtt cagctgagtg
    3401  aaagcaccta tgtgttcacc tgcaacggta ctggtcgctt cctgttcttc
    3451  ttcaactcta ctgttgatgc aacctccacc atttctggta tggaggtgaa
    3501  gcaaaagagt tcaaccgatg acaaaggaga gacaacgata ttggaactac
    3551  tcgctactga atcaggtggt aagatagcaa tattggcgga taagggcacc
    3601  atcacttggt gggcctgcag gaactaggtt tatctattat tgggccttcg
    3651  tgttgttagg ggcagtggaa gcgtcggtct agccagccgt cccctgggta
    3701  gtgtgctctg tctatgtaca ccactactcg gctttcacaa acaaccggac
    3751  tcccatacta tgtaaattat gttgattgct tcttcttccc ccttttaata
    3801  tctcctctca tctcctctac acttggaact cataaaatcc ttcgggtggg
    3851  cttgagtttc gggtactatt tgaaatcccc tccacaaccg ccatagttgt
    3901  gaggcagccc